|
|
| (49 intermediate revisions by 4 users not shown) |
| Line 26: |
Line 26: |
| | {{Team:UofC_Calgary/assets/plugins/fancybox/jquery.fancybox.pack.js}} | | {{Team:UofC_Calgary/assets/plugins/fancybox/jquery.fancybox.pack.js}} |
| | {{Team:UofC_Calgary/assets/base/js/components.js}} | | {{Team:UofC_Calgary/assets/base/js/components.js}} |
| − | {{Team:UofC_Calgary/assets/base/js/app.js}} | + | {{Team:UofC_Calgary/assets/base/js/app.js}}<html> |
| − | | + | |
| − | <html lang="en"> | + | |
| − | <!--<![endif]-->
| + | |
| − | <!-- BEGIN HEAD -->
| + | |
| − | | + | |
| | <head> | | <head> |
| − |
| |
| − | <meta charset="utf-8" />
| |
| | <title>iGEM Calgary 2016</title> | | <title>iGEM Calgary 2016</title> |
| − | <meta http-equiv="X-UA-Compatible" content="IE=edge">
| |
| − | <meta content="width=device-width, initial-scale=1.0" name="viewport" />
| |
| − | <meta http-equiv="Content-type" content="text/html; charset=utf-8">
| |
| − | <meta content="" name="description" />
| |
| − | <meta content="" name="author" />
| |
| − |
| |
| − | <link rel="shortcut icon" href="favicon.ico" />
| |
| | </head> | | </head> |
| − | | + | <body> |
| − | <body class="c-layout-header-fixed"> | + | |
| | + | <!-- BEGIN HEAD --> |
| | + | <meta charset="utf-8"> |
| | + | <meta content="IE=edge" http-equiv="X-UA-Compatible"> |
| | + | <meta content="width=device-width, initial-scale=1.0" name="viewport"> |
| | + | <meta content="text/html; charset=utf-8" http-equiv="Content-type"> |
| | + | <meta content="" name="description"> |
| | + | <meta content="" name="author"> |
| | + | <link href="favicon.ico" rel="shortcut icon"> |
| | <!-- BEGIN: LAYOUT/HEADERS/HEADER-1 --> | | <!-- BEGIN: LAYOUT/HEADERS/HEADER-1 --> |
| | <!-- BEGIN: HEADER --> | | <!-- BEGIN: HEADER --> |
| − | <header class="c-layout-header c-layout-header-3 c-layout-header-default-mobile c-header-seethrough" style="padding-top: 10px; | + | <header class= |
| − | top: 0;
| + | "c-layout-header c-layout-header-3 c-layout-header-default-mobile c-header-seethrough" |
| − | position: fixed;
| + | style= |
| − | z-index: 9995;
| + | "padding-top: 10px; top: 0; position: fixed; z-index: 9995; width: 100%;"> |
| − | width: 100%;
| + | |
| − | "> | + | |
| | <div class="c-navbar"> | | <div class="c-navbar"> |
| − | <div class="container-fluid" style="padding-left: 20px; padding-right: 20px;"> | + | <div class="container-fluid" style= |
| | + | "padding-left: 20px; padding-right: 20px;"> |
| | <!-- BEGIN: BRAND --> | | <!-- BEGIN: BRAND --> |
| | <div class="c-navbar-wrapper clearfix"> | | <div class="c-navbar-wrapper clearfix"> |
| | <div class="c-brand c-pull-left"> | | <div class="c-brand c-pull-left"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/sandbox" class="c-logo"> | + | <a class="c-logo" href= |
| − | <img src="https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png" alt="iGEM" class="c-desktop-logo">
| + | "https://2016.igem.org/Team:UofC_Calgary"><img alt= |
| − | <img src="https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png" alt="iGEM" class="c-desktop-logo-inverse">
| + | "iGEM" class="c-desktop-logo" src= |
| − | <img src="https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png" alt="iGEM" class="c-mobile-logo">
| + | "https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png"> |
| − | </a>
| + | <img alt="iGEM" class="c-desktop-logo-inverse" src= |
| − | <button class="c-hor-nav-toggler" type="button" data-target=".c-mega-menu"> | + | "https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png"> |
| − | <span class="c-line"></span>
| + | <img alt="iGEM" class="c-mobile-logo" src= |
| − | <span class="c-line"></span>
| + | "https://static.igem.org/mediawiki/2016/9/9a/Logo-1.png"></a> |
| − | <span class="c-line"></span>
| + | <button class="c-hor-nav-toggler" data-target= |
| − | </button>
| + | ".c-mega-menu" type="button"><span class= |
| − | </div> | + | "c-line"></span> <span class="c-line"></span> |
| − | <!-- END: BRAND -->
| + | <span class="c-line"></span></button> |
| | + | </div><!-- END: BRAND --> |
| | <!-- BEGIN: HOR NAV --> | | <!-- BEGIN: HOR NAV --> |
| | <!-- BEGIN: LAYOUT/HEADERS/MEGA-MENU --> | | <!-- BEGIN: LAYOUT/HEADERS/MEGA-MENU --> |
| | <!-- BEGIN: MEGA MENU --> | | <!-- BEGIN: MEGA MENU --> |
| − | <nav class="c-mega-menu c-pull-right c-mega-menu-dark c-mega-menu-dark-mobile c-fonts-uppercase c-fonts-bold"> | + | <nav class= |
| − | <!-- BEGIN: MEGA MENU -->
| + | "c-mega-menu c-pull-right c-mega-menu-dark c-mega-menu-dark-mobile c-fonts-uppercase c-fonts-bold"> |
| | + | <!-- BEGIN: MEGA MENU --> |
| | <!-- BEGIN: MEGA MENU --> | | <!-- BEGIN: MEGA MENU --> |
| | <ul class="nav navbar-nav c-theme-nav"> | | <ul class="nav navbar-nav c-theme-nav"> |
| | <li class="c-menu-type-classic"> | | <li class="c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary" class="c-link dropdown-toggle">Home</a> | + | <a class="c-link dropdown-toggle" href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary">Home</a> |
| | </li> | | </li> |
| | <li class="c-menu-type-classic"> | | <li class="c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Description" class="c-link dropdown-toggle">Project</a> | + | <a class="c-link dropdown-toggle" href= |
| − | <ul class="dropdown-menu c-menu-type-inline c-pull-left"> | + | "https://2016.igem.org/Team:UofC_Calgary/Description"> |
| | + | Project</a> |
| | + | <ul class= |
| | + | "dropdown-menu c-menu-type-inline c-pull-left"> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Description">Problem</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Description"> |
| | + | Problem</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Experiments">Our Experiments</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Experiments"> |
| | + | Our Experiments</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Results">Our Results</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Results"> |
| | + | Our Results</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Model">Model</a> | + | <a href= |
| − | </li> | + | "https://2016.igem.org/Team:UofC_Calgary/Model"> |
| | + | Model</a> |
| | + | </li><li> |
| | + | <a href="https://2016.igem.org/Team:UofC_Calgary/Design">Applied Design</a> |
| | + | </li> |
| | <li> | | <li> |
| | <a href="https://2016.igem.org/Team:UofC_Calgary/Parts">Parts Registry</a> | | <a href="https://2016.igem.org/Team:UofC_Calgary/Parts">Parts Registry</a> |
| | </li> | | </li> |
| | + | <li> |
| | + | <a href="https://2016.igem.org/Team:UofC_Calgary/Composite_Part">Composite Parts</a> |
| | + | </li> |
| | + | |
| | </ul> | | </ul> |
| | </li> | | </li> |
| | <li class="c-menu-type-classic"> | | <li class="c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Judging" class="c-link">Judging</a> | + | <a class="c-link" href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Judging"> |
| | + | Judging</a> |
| | </li> | | </li> |
| − |
| |
| | <li class="c-menu-type-classic"> | | <li class="c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Human_Practices" class="c-link dropdown-toggle">Human Practices</a> | + | <a class="c-link dropdown-toggle" href= |
| − | <ul class="dropdown-menu c-menu-type-inline c-pull-left"> | + | "https://2016.igem.org/Team:UofC_Calgary/Human_Practices"> |
| | + | Human Practices</a> |
| | + | <ul class= |
| | + | "dropdown-menu c-menu-type-inline c-pull-left"> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Integrated_Practices">Integrated Practices</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Integrated_Practices"> |
| | + | Integrated Practices</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Collaborations">Collaborations</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Collaborations"> |
| | + | Collaborations</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Engagement">Engagement</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Engagement"> |
| | + | Engagement</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Safety">Safety</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Safety"> |
| | + | Safety</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/HP/Silver">Silver</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/HP/Silver"> |
| | + | Silver</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/HP/Gold">Gold</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/HP/Gold"> |
| | + | Gold</a> |
| | + | </li> |
| | + | <li> |
| | + | <a href="https://2016.igem.org/Team:UofC_Calgary/Policy"> Policy Brief </a> |
| | </li> | | </li> |
| | </ul> | | </ul> |
| | </li> | | </li> |
| | <li class="c-active c-menu-type-classic"> | | <li class="c-active c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Notebook" class="c-link">Notebook</a> | + | <a class="c-link" href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Notebook"> |
| | + | Notebook</a> |
| | </li> | | </li> |
| | <li class="c-menu-type-classic"> | | <li class="c-menu-type-classic"> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Team" class="c-link dropdown-toggle">Team</a> | + | <a class="c-link dropdown-toggle" href= |
| − | <ul class="dropdown-menu c-menu-type-inline c-pull-left"> | + | "https://2016.igem.org/Team:UofC_Calgary/Team">Team</a> |
| | + | <ul class= |
| | + | "dropdown-menu c-menu-type-inline c-pull-left"> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Team">Meet Our Team</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Team"> |
| | + | Meet Our Team</a> |
| | </li> | | </li> |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Team:UofC_Calgary/Attributions">Attributions</a> | + | <a href= |
| | + | "https://2016.igem.org/Team:UofC_Calgary/Attributions"> |
| | + | Attributions</a> |
| | </li> | | </li> |
| − |
| |
| | </ul> | | </ul> |
| | </li> | | </li> |
| − |
| |
| | <li> | | <li> |
| − | <a href="https://2016.igem.org/Main_Page" data-toggle="modal" data-target="#login-form" class="c-btn-border-opacity-04 c-btn btn-no-focus c-btn-header btn btn-sm c-btn-border-1x c-btn-white c-btn-circle c-btn-uppercase c-btn-sbold"><i class="icon-chemistry"></i> iGEM </a> | + | <a class= |
| | + | "c-btn-border-opacity-04 c-btn btn-no-focus c-btn-header btn btn-sm c-btn-border-1x c-btn-white c-btn-circle c-btn-sbold" |
| | + | data-target="#login-form" data-toggle="modal" |
| | + | href="https://2016.igem.org/Main_Page"><i class= |
| | + | "icon-chemistry"></i> iGEM</a> |
| | </li> | | </li> |
| | <li class="c-quick-sidebar-toggler-wrapper"> | | <li class="c-quick-sidebar-toggler-wrapper"> |
| − | <a href="#" class="c-quick-sidebar-toggler"> | + | <a class="c-quick-sidebar-toggler" href= |
| − | <span class="c-line"></span>
| + | "#"><span class="c-line"></span> <span class= |
| − | <span class="c-line"></span>
| + | "c-line"></span> <span class= |
| − | <span class="c-line"></span>
| + | "c-line"></span></a> |
| − | </a>
| + | |
| | </li> | | </li> |
| − | </ul> | + | </ul><!-- END MEGA MENU --> |
| − | <!-- END MEGA MENU -->
| + | |
| | <!-- END MEGA MENU --> | | <!-- END MEGA MENU --> |
| − | </nav> | + | </nav><!-- END: MEGA MENU --> |
| − | <!-- END: MEGA MENU -->
| + | |
| | <!-- END: LAYOUT/HEADERS/MEGA-MENU --> | | <!-- END: LAYOUT/HEADERS/MEGA-MENU --> |
| | <!-- END: HOR NAV --> | | <!-- END: HOR NAV --> |
| Line 164: |
Line 203: |
| | </div> | | </div> |
| | </div> | | </div> |
| − | </header> | + | </header><!-- END: HEADER --> |
| − | <!-- END: HEADER -->
| + | |
| | <!-- END: LAYOUT/HEADERS/HEADER-1 --> | | <!-- END: LAYOUT/HEADERS/HEADER-1 --> |
| | <!-- BEGIN: LAYOUT/SIDEBARS/QUICK-SIDEBAR --> | | <!-- BEGIN: LAYOUT/SIDEBARS/QUICK-SIDEBAR --> |
| | <nav class="c-layout-quick-sidebar"> | | <nav class="c-layout-quick-sidebar"> |
| | <div class="c-header"> | | <div class="c-header"> |
| − | <button type="button" class="c-link c-close"> | + | <button class="c-link c-close" type="button"><i class= |
| − | <i class="icon-login"></i>
| + | "icon-login"></i></button> |
| − | </button>
| + | |
| | </div> | | </div> |
| | <div class="c-content"> | | <div class="c-content"> |
| Line 178: |
Line 215: |
| | <h3>Theme Colors</h3> | | <h3>Theme Colors</h3> |
| | <div class="c-settings"> | | <div class="c-settings"> |
| − | <span class="c-color c-default c-active" data-color="default"></span> | + | <span class="c-color c-default c-active" data-color= |
| − | <span class="c-color c-green1" data-color="green1"></span>
| + | "default"></span> <span class="c-color c-green1" |
| − | <span class="c-color c-green2" data-color="green2"></span>
| + | data-color="green1"></span> <span class="c-color c-green2" |
| − | <span class="c-color c-green3" data-color="green3"></span>
| + | data-color="green2"></span> <span class="c-color c-green3" |
| − | <span class="c-color c-yellow1" data-color="yellow1"></span>
| + | data-color="green3"></span> <span class="c-color c-yellow1" |
| − | <span class="c-color c-yellow2" data-color="yellow2"></span>
| + | data-color="yellow1"></span> <span class= |
| − | <span class="c-color c-yellow3" data-color="yellow3"></span> | + | "c-color c-yellow2" data-color="yellow2"></span> |
| − | <span class="c-color c-red1" data-color="red1"></span>
| + | <span class="c-color c-yellow3" data-color= |
| − | <span class="c-color c-red2 " data-color="red2"></span>
| + | "yellow3"></span> <span class="c-color c-red1" data-color= |
| − | <span class="c-color c-red3" data-color="red3"></span>
| + | "red1"></span> <span class="c-color c-red2" data-color= |
| − | <span class="c-color c-purple1" data-color="purple1"></span>
| + | "red2"></span> <span class="c-color c-red3" data-color= |
| − | <span class="c-color c-purple2" data-color="purple2"></span>
| + | "red3"></span> <span class="c-color c-purple1" data-color= |
| − | <span class="c-color c-purple3" data-color="purple3"></span>
| + | "purple1"></span> <span class="c-color c-purple2" |
| | + | data-color="purple2"></span> <span class= |
| | + | "c-color c-purple3" data-color="purple3"></span> |
| | <span class="c-color c-blue1" data-color="blue1"></span> | | <span class="c-color c-blue1" data-color="blue1"></span> |
| | <span class="c-color c-blue2" data-color="blue2"></span> | | <span class="c-color c-blue2" data-color="blue2"></span> |
| Line 205: |
Line 244: |
| | <h3>Header Type</h3> | | <h3>Header Type</h3> |
| | <div class="c-settings"> | | <div class="c-settings"> |
| − | <input type="button" class="c-setting_header-type btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" data-value="boxed" value="boxed" /> | + | <input class= |
| − | <input type="button" class="c-setting_header-type btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" data-value="fluid" value="fluid" /> | + | "c-setting_header-type btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" |
| | + | data-value="boxed" type="button" value="boxed"> |
| | + | <input class= |
| | + | "c-setting_header-type btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" |
| | + | data-value="fluid" type="button" value="fluid"> |
| | </div> | | </div> |
| | </div> | | </div> |
| Line 212: |
Line 255: |
| | <h3>Header Mode</h3> | | <h3>Header Mode</h3> |
| | <div class="c-settings"> | | <div class="c-settings"> |
| − | <input type="button" class="c-setting_header-mode btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" data-value="fixed" value="fixed" /> | + | <input class= |
| − | <input type="button" class="c-setting_header-mode btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" data-value="static" value="static" /> | + | "c-setting_header-mode btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" |
| | + | data-value="fixed" type="button" value="fixed"> |
| | + | <input class= |
| | + | "c-setting_header-mode btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" |
| | + | data-value="static" type="button" value="static"> |
| | </div> | | </div> |
| | </div> | | </div> |
| Line 219: |
Line 266: |
| | <h3>Mega Menu Style</h3> | | <h3>Mega Menu Style</h3> |
| | <div class="c-settings"> | | <div class="c-settings"> |
| − | <input type="button" class="c-setting_megamenu-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" data-value="dark" value="dark" /> | + | <input class= |
| − | <input type="button" class="c-setting_megamenu-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" data-value="light" value="light" />
| + | "c-setting_megamenu-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" |
| | + | data-value="dark" type="button" value="dark"> <input class= |
| | + | "c-setting_megamenu-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" |
| | + | data-value="light" type="button" value="light"> |
| | </div> | | </div> |
| | </div> | | </div> |
| Line 226: |
Line 276: |
| | <h3>Font Style</h3> | | <h3>Font Style</h3> |
| | <div class="c-settings"> | | <div class="c-settings"> |
| − | <input type="button" class="c-setting_font-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" data-value="default" value="default" /> | + | <input class= |
| − | <input type="button" class="c-setting_font-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" data-value="light" value="light" /> | + | "c-setting_font-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase active" |
| | + | data-value="default" type="button" value="default"> |
| | + | <input class= |
| | + | "c-setting_font-style btn btn-sm c-btn-square c-btn-border-1x c-btn-white c-btn-sbold c-btn-uppercase" |
| | + | data-value="light" type="button" value="light"> |
| | </div> | | </div> |
| | </div> | | </div> |
| | </div> | | </div> |
| − | </nav> | + | </nav><!-- END: LAYOUT/SIDEBARS/QUICK-SIDEBAR --> |
| − | <!-- END: LAYOUT/SIDEBARS/QUICK-SIDEBAR -->
| + | |
| | <!-- BEGIN: PAGE CONTAINER --> | | <!-- BEGIN: PAGE CONTAINER --> |
| | <div class="c-layout-page" style="padding-top: 86px;"> | | <div class="c-layout-page" style="padding-top: 86px;"> |
| Line 238: |
Line 291: |
| | <!--BEGIN: SLIDE #1 --> | | <!--BEGIN: SLIDE #1 --> |
| | <div class="row-fluid"> | | <div class="row-fluid"> |
| − | | + | |
| − | <div style="position: relative ;display: inline-block;"> | + | <div style="position: relative;"> |
| | | | |
| − | | + | <a id="img-scroll1"> |
| − | <img style="position:absolute;left:27%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/a/a7/T--UofC_Calgary--biotarget-icon.jpg" alt="1" type="image" id="first" /> | + | <img style="position:absolute;left:27%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/a/a7/T--UofC_Calgary--biotarget-icon.jpg" alt="1" type="image" id="first"> |
| − | </a>
| + | </a> |
| | | | |
| − | | + | <a id="img-scroll2"> |
| − | <img style="position:absolute;left:43%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/9/95/T--UofC_Calgary--chassis-icon.jpg" alt="1" type="image" /> | + | <img style="position:absolute;left:43%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/9/95/T--UofC_Calgary--chassis-icon.jpg" alt="1" type="image"> |
| − | </a>
| + | </a> |
| | | | |
| − | | + | <a id="img-scroll3"> |
| − | <img style="position:absolute;left:58%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/a/a5/T--UofC_Calgary--device-icon.jpg" alt="1" type="image" /> | + | <img style="position:absolute;left:58%;top:80%;max-width: 15%;cursor: pointer;" src="https://static.igem.org/mediawiki/2016/a/a5/T--UofC_Calgary--device-icon.jpg" alt="1" type="image"> |
| − | </a>
| + | </a> |
| | | | |
| − | <img style="width:100%; height: 100%" src="https://static.igem.org/mediawiki/2016/f/f3/T--UofC_Calgary--notebook.jpg" alt="bg" /> | + | <img style="width:100%; height: 100%" src="https://static.igem.org/mediawiki/2016/f/f3/T--UofC_Calgary--notebook.jpg" alt="bg"> |
| − | | + | |
| − | </div> | + | |
| | </div> | | </div> |
| | </div> | | </div> |
| − | <!-- END: LAYOUT/SLIDERS/REVO-SLIDER-1 --> | + | </div><!-- END: LAYOUT/SLIDERS/REVO-SLIDER-1 --> |
| − | | + | |
| | <!-- BEGIN: CONTENT/MISC/ABOUT-1 --> | | <!-- BEGIN: CONTENT/MISC/ABOUT-1 --> |
| − | <div class="c-content-box c-size-md"> | + | <div class="c-content-box c-size-md c-bg-white" > |
| | + | <div class="container"> |
| | + | <div class="col-md-12"> |
| | + | <!-- Begin: Title 1 component --> |
| | + | <div class="c-content-title-1"> |
| | + | <a href="https://static.igem.org/mediawiki/2016/2/21/T--UofC_Calgary--BioTJournalFreeze.pdf"><h3 class="c-font-uppercase c-font-bold">BioTarget Notebook</h3></a> |
| | + | <div class="c-line-left c-theme-bg"> |
| | + | </div> |
| | + | </div> |
| | + | <!-- End--> |
| | + | <center><object data="https://static.igem.org/mediawiki/2016/2/21/T--UofC_Calgary--BioTJournalFreeze.pdf" type="application/pdf" width="100%" height="600px"> |
| | + | Your device does not support embed PDFs. Please click the following link to open up the PDF. <a href="https://static.igem.org/mediawiki/2016/2/21/T--UofC_Calgary--BioTJournalFreeze.pdf">Biotarget_Journal.pdf</a> |
| | + | </object> </center> |
| | | | |
| − | he
| |
| − | <style type="text/css">
| |
| − | @import url('https://themes.googleusercontent.com/fonts/css?kit=m0tazYRimFnV1hoGKbgtnw');
| |
| − | .lst-kix_list_48-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-1
| |
| − | }
| |
| − | ul.lst-kix_list_9-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_42-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_9-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_42-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_42-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_42-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_42-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_42-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_42-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_42-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_42-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_24-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_27-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_27-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_24-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_24-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_27-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_27-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_23-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_16-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_23-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_23-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_24-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_16-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_16-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_23-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_23-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_43-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_48-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-2 0
| |
| − | }
| |
| − | .lst-kix_list_22-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_43-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_43-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_22-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_22-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_43-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_41-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_25-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_41-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_29-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_40-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_29-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_41-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_29-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_18-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_47-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_26-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_47-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-2
| |
| − | }
| |
| − | ul.lst-kix_list_5-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-1 0
| |
| − | }
| |
| − | ul.lst-kix_list_36-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_36-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_36-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_26-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_21-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_36-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_26-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_23-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_45-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_23-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_23-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_44-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_48-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-0
| |
| − | }
| |
| − | .lst-kix_list_39-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_44-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_12-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_12-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_12-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_12-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_12-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_12-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_12-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_12-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_12-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_49-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_43-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_43-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_49-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_22-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_27-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_7-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_39-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_49-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_49-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_46-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_38-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_38-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-7
| |
| − | }
| |
| − | ul.lst-kix_list_25-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_41-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_20-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_28-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_25-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_41-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_25-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_25-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_14-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_27-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_40-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_43-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_43-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_19-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_43-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_47-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_1-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_32-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_32-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_37-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_19-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_47-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_37-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_37-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_37-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_46-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_37-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_18-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_38-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_18-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-3
| |
| − | }
| |
| − | .lst-kix_list_38-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_38-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_45-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_45-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_45-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-2>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-2, lower-roman) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_45-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_45-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_45-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_45-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-4>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-4, lower-latin) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_48-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-5 0
| |
| − | }
| |
| − | ul.lst-kix_list_3-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_18-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_3-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_45-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_45-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_34-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_34-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_34-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_34-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_21-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_21-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_20-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_29-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_49-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_20-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_10-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_1-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_49-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_2-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_48-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-3 0
| |
| − | }
| |
| − | .lst-kix_list_35-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_3-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_26-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_8-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_3-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_30-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_8-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_26-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_21-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_21-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_48-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-7 0
| |
| − | }
| |
| − | .lst-kix_list_45-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_45-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_25-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_16-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_50-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_44-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_50-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-6 0
| |
| − | }
| |
| − | .lst-kix_list_39-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_50-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-6
| |
| − | }
| |
| − | ul.lst-kix_list_50-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_41-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_41-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_27-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_43-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_43-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_41-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_18-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_39-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_30-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_30-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_31-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_36-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_30-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_30-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_4-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_48-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-8 0
| |
| − | }
| |
| − | .lst-kix_list_25-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_46-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_41-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_9-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_33-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_12-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_11-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_32-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_1-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_49-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_48-7>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-7, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_40-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_28-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_14-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_28-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_14-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_28-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_17-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_17-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_32-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_17-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_17-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_5-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_5-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_5-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_5-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_5-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_50-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_50-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_6-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_6-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_50-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_50-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_50-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_39-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_6-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_50-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_50-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_6-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_50-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_50-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_39-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_6-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_34-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-0>li:before {
| |
| − | content: "- "
| |
| − | }
| |
| − | .lst-kix_list_13-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_15-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_31-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_31-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_15-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_19-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_19-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_15-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_19-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_48-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-4 0
| |
| − | }
| |
| − | .lst-kix_list_33-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_48-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-5
| |
| − | }
| |
| − | .lst-kix_list_12-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_32-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_12-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_33-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_33-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_32-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_34-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_13-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_34-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_34-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_13-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_33-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_33-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_34-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_24-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_30-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_35-0>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_30-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_3-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_3-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_3-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_8-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_3-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_8-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_13-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_3-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_13-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_8-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_35-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_13-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_13-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-4
| |
| − | }
| |
| − | .lst-kix_list_11-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_46-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_46-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_48-0 0
| |
| − | }
| |
| − | .lst-kix_list_4-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_17-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_4-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_4-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_4-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_46-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_17-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_17-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_17-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_35-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_26-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_2-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_26-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-5>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-5, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_10-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_13-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_18-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_18-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_26-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-1>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-1, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_36-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_15-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_10-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_10-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_36-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_15-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_15-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_15-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_15-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_15-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_29-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_32-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_11-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_6-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_33-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_1-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_6-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_6-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_6-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_49-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_37-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_13-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_48-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_48-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_48-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_33-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_2-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_37-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_37-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_37-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_12-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_20-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_20-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_20-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_47-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_47-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_19-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_19-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_47-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_19-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_42-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_37-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_42-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_42-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_46-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_38-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_37-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_37-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_37-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_31-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_18-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_38-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_31-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_38-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_22-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_22-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-0>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-0, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_22-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_22-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-6>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_18-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_39-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_39-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_10-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_18-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_22-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_10-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_11-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_36-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_11-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_46-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_44-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_44-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_44-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_20-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_2-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_2-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_2-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_2-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_33-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_33-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_33-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-8>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-8, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_27-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_33-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_28-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_30-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_35-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_3-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_26-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_44-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_21-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_8-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_26-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_3-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_21-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_11-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_45-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_45-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_44-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_44-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_39-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_17-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_30-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_27-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_43-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_22-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_7-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_48-3>li:before {
| |
| − | content: "" counter(lst-ctn-kix_list_48-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_48-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_48-8
| |
| − | }
| |
| − | .lst-kix_list_31-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_4-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_15-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_36-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_9-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_10-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_40-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_40-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_41-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_20-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_29-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_49-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_28-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_1-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_33-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_40-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_12-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_34-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_2-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol {
| |
| − | margin: 0;
| |
| − | padding: 0
| |
| − | }
| |
| − | table td,
| |
| − | table th {
| |
| − | padding: 0
| |
| − | }
| |
| − | .c109 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | background-color: #ed7d31;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 75.7pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c110 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | background-color: #ffeb9c;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c106 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | background-color: #ffeb9c;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 171.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c83 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | background-color: #c6efce;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 49.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c111 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | background-color: #9cc2e5;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 27.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c60 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 27.4pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c44 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 106.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c102 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 171.4pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c21 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 106pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c14 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 76.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c0 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 21.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c88 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 171.4pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c74 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 75.7pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c101 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.8pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c57 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 93.7pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c75 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 69.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c86 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 293.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c42 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 55.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c96 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 101.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c36 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 107.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c77 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.8pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c50 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 49.1pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c84 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.9pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c35 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c59 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 194pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c99 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 63.6pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c40 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 61.5pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c12 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 37.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c32 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 82.9pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c67 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 137.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c66 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 87pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c80 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 237.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c10 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 43.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c90 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 82.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c69 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 75.7pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c28 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 36.9pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c53 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 87.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c97 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 89pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c45 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 70.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c26 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 62.6pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c55 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 65pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c82 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 169.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c15 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 97.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c8 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 72.3pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c94 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 167.1pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c18 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 62.9pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c91 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 112.4pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c43 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 67.2pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c105 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 49.1pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c34 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 47pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c107 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #cccccc;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 27.4pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c95 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 91.3pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c73 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0.8pt 0.8pt 0.8pt 0.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: middle;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 80pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c37 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 5.8pt 0pt 5.8pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 101.6pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c61 {
| |
| − | border-right-style: solid;
| |
| − | padding: 0pt 2.2pt 0pt 2.2pt;
| |
| − | border-bottom-color: #cccccc;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #cccccc;
| |
| − | vertical-align: bottom;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 171.4pt;
| |
| − | border-top-color: #cccccc;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c5 {
| |
| − | margin-left: 36pt;
| |
| − | padding-top: 0pt;
| |
| − | padding-left: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2
| |
| − | }
| |
| − | .c29 {
| |
| − | color: #000000;
| |
| − | font-weight: 400;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 11pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c6 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: center;
| |
| − | height: 12pt
| |
| − | }
| |
| − | .c16 {
| |
| − | color: #000000;
| |
| − | font-weight: 400;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 9pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c17 {
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c1 {
| |
| − | color: #000000;
| |
| − | font-weight: 400;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c103 {
| |
| − | color: #9c6500;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 9pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c108 {
| |
| − | color: #006100;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 9pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c89 {
| |
| − | color: #ffffff;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 9pt;
| |
| − | font-family: "Arial";
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c2 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: right
| |
| − | }
| |
| − | .c20 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.15;
| |
| − | text-align: left;
| |
| − | height: 12pt
| |
| − | }
| |
| − | .c33 {
| |
| − | margin-left: -2.2pt;
| |
| − | border-spacing: 0;
| |
| − | border-collapse: collapse;
| |
| − | margin-right: auto
| |
| − | }
| |
| − | .c85 {
| |
| − | margin-left: -1.1pt;
| |
| − | border-spacing: 0;
| |
| − | border-collapse: collapse;
| |
| − | margin-right: auto
| |
| − | }
| |
| − | .c4 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | color: #000000;
| |
| − | text-decoration: underline
| |
| − | }
| |
| − | .c47 {
| |
| − | margin-left: -0.8pt;
| |
| − | border-spacing: 0;
| |
| − | border-collapse: collapse;
| |
| − | margin-right: auto
| |
| − | }
| |
| − | .c98 {
| |
| − | color: #0daf49;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c13 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | text-align: left
| |
| − | }
| |
| − | .c9 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c23 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | font-weight: 700
| |
| − | }
| |
| − | .c25 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c68 {
| |
| − | vertical-align: sub;
| |
| − | font-size: 6pt;
| |
| − | font-family: "Arial"
| |
| − | }
| |
| − | .c72 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Wingdings";
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c65 {
| |
| − | background-color: #ffffff;
| |
| − | font-family: "Times New Roman";
| |
| − | color: #ff0000
| |
| − | }
| |
| − | .c38 {
| |
| − | font-size: 24pt;
| |
| − | font-family: "Times New Roman";
| |
| − | font-weight: 700
| |
| − | }
| |
| − | .c22 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial";
| |
| − | color: #000000
| |
| − | }
| |
| − | .c52 {
| |
| − | font-size: 11pt;
| |
| − | font-family: "Arial";
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c31 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Arial"
| |
| − | }
| |
| − | .c49 {
| |
| − | background-color: #ffffff;
| |
| − | color: #344043
| |
| − | }
| |
| − | .c93 {
| |
| − | max-width: 432pt;
| |
| − | padding: 72pt 90pt 72pt 90pt
| |
| − | }
| |
| − | .c56 {
| |
| − | color: inherit;
| |
| − | text-decoration: inherit
| |
| − | }
| |
| − | .c19 {
| |
| − | margin-left: 72pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c64 {
| |
| − | background-color: #ffffff;
| |
| − | color: #59595b
| |
| − | }
| |
| − | .c62 {
| |
| − | margin-left: 36pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c92 {
| |
| − | margin-left: 32.2pt;
| |
| − | padding-left: 3.2pt
| |
| − | }
| |
| − | .c11 {
| |
| − | orphans: 2;
| |
| − | widows: 2
| |
| − | }
| |
| − | .c30 {
| |
| − | padding: 0;
| |
| − | margin: 0
| |
| − | }
| |
| − | .c81 {
| |
| − | font-size: 10pt;
| |
| − | font-family: "Times New Roman"
| |
| − | }
| |
| − | .c3 {
| |
| − | height: 0pt
| |
| − | }
| |
| − | .c39 {
| |
| − | color: #366091
| |
| − | }
| |
| − | .c27 {
| |
| − | text-align: center
| |
| − | }
| |
| − | .c41 {
| |
| − | font-style: italic
| |
| − | }
| |
| − | .c48 {
| |
| − | margin-left: 72pt
| |
| − | }
| |
| − | .c70 {
| |
| − | vertical-align: super
| |
| − | }
| |
| − | .c76 {
| |
| − | background-color: #e7e7e7
| |
| − | }
| |
| − | .c24 {
| |
| − | height: 12pt
| |
| − | }
| |
| − | .c87 {
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c58 {
| |
| − | color: #3c78d8
| |
| − | }
| |
| − | .c100 {
| |
| − | color: #3d85c6
| |
| − | }
| |
| − | .c71 {
| |
| − | background-color: #ffffff
| |
| − | }
| |
| − | .c112 {
| |
| − | color: #1155cc
| |
| − | }
| |
| − | .c51 {
| |
| − | height: 14pt
| |
| − | }
| |
| − | .c46 {
| |
| − | color: #000000
| |
| − | }
| |
| − | .c7 {
| |
| − | height: 15pt
| |
| − | }
| |
| − | .c78 {
| |
| − | margin-left: 18pt
| |
| − | }
| |
| − | .c79 {
| |
| − | color: #e69138
| |
| − | }
| |
| − | .c104 {
| |
| − | height: 45pt
| |
| − | }
| |
| − | .c54 {
| |
| − | text-decoration: underline
| |
| − | }
| |
| − | .c63 {
| |
| − | margin-left: 36pt
| |
| − | }
| |
| − | .title {
| |
| − | padding-top: 24pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 36pt;
| |
| − | padding-bottom: 6pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | .subtitle {
| |
| − | padding-top: 18pt;
| |
| − | color: #666666;
| |
| − | font-size: 24pt;
| |
| − | padding-bottom: 4pt;
| |
| − | font-family: "Georgia";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | font-style: italic;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | li {
| |
| − | color: #000000;
| |
| − | font-size: 12pt;
| |
| − | font-family: "Cambria"
| |
| − | }
| |
| − | p {
| |
| − | margin: 0;
| |
| − | color: #000000;
| |
| − | font-size: 12pt;
| |
| − | font-family: "Cambria"
| |
| − | }
| |
| − | h1 {
| |
| − | padding-top: 5pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 24pt;
| |
| − | padding-bottom: 5pt;
| |
| − | font-family: "Times New Roman";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h2 {
| |
| − | padding-top: 18pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 18pt;
| |
| − | padding-bottom: 4pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h3 {
| |
| − | padding-top: 14pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 14pt;
| |
| − | padding-bottom: 4pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h4 {
| |
| − | padding-top: 12pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 12pt;
| |
| − | padding-bottom: 2pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h5 {
| |
| − | padding-top: 11pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 11pt;
| |
| − | padding-bottom: 2pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h6 {
| |
| − | padding-top: 10pt;
| |
| − | color: #000000;
| |
| − | font-weight: 700;
| |
| − | font-size: 10pt;
| |
| − | padding-bottom: 2pt;
| |
| − | font-family: "Cambria";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | </style>
| |
| − | <div class="c71 c93">
| |
| − | <p class="c11"><span class="c23 c46">Pre-Summer Preparation work</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_1-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Was introduced to the Bowman-Birk Inhibitor(BBI) by Dr. Aaron Goodarzi, who is a radiooncology researcher at the Charbonneau Cancer Institute at the University of Calgary</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">BBI: a protease inhibitor derived from soybeans, which was found to have radioprotective properties by a lab in Germany headed by Dr. Klaus Dittman </span><span class="c31 c58">(</span><span class="c31 c58 c71">Dittmann K, Loffler H, Bamberg M, Rodemann HP. Bowman-Birk proteinase inhibitor (BBI) modulates radiosensitivity and radiation-induced differentiation of human fibroblasts in culture. Radiother. Oncol. 1995;34:137–143.)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Decided on doing the BBI as our radioprotective peptide of choice; found the sequence of the truncated or modified version of the BBI which has been shown to retain its functions as a radioprotector </span><span class="c31 c58">(</span><span class="c31 c58 c71">Dittmann KH, Gueven N, Mayer C, Rodemann HP. Characterization of the amino acids essential for the photo- and radioprotective effects of a Bowman-Birk protease inhibitor-derived nonapeptide. Protein Engineering. 2001;14:157–160.)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">The whole BBI protein (70 a.a.) can cause problems in blood clotting; 9 a.a. Sequence avoids that issue, because the section of the peptide that acts as a protease inhibitor is cut off</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Previous literature has also suggested a potential molecular pathway by which BBI works. </span><span class="c31 c58">(</span><span class="c31 c58 c71">Gueven N, Dittmann K, Mayer C, Rodemann HP. Bowman-Birk protease inhibitor reduces the radiation-induced activation of the EGF receptor and induces tyrosine phosphatase activity. Intl. J. Radiat. Biol. 1998;73:157–162.)</span><span class="c65"> </span><span class="c22">BBI mostly works in Non-Homologous End Joining pathways, which is expected as that is the most prevalent mode of DNA double stranded repair in cells</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Looked into other potential peptides that we can use in case the BBI does not work out: KTI, Glutathione, antioxidants</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">KTI: another radioprotective peptide that has been found to be effective in protecting against certain types of radiation that the BBI does not </span><span class="c31 c58">(Van den Hout, R.; Pouw, M.; Gruppen, H. Inactivation kinetics study of the Kunitz soybean trypsin inhibitor and the Bowman−Birk inhibitor. J. Agric. Food Chem. 1998, 46 (1), 281−285.)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Glutathione: a reactive oxygen species “sink” that quenches reactive oxygen species by binding to its lone electron. Mostly works near the mitochondria of the </span><span class="c31 c58">(</span><span class="c31 c58 c71">Chatterjee A. Reduced Glutathione: A Radioprotector or a Modulator of DNA-Repair Activity? </span><span class="c31 c41 c58 c71">Nutrients</span><span class="c31 c58 c71">. 2013;5(2):525-542. doi:10.3390/nu5020525.)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Antioxidants: works by a variety of pathways </span><span class="c31 c58">(</span><span class="c31 c58 c71">Weisse J. F. and Landauer M. R., Radioprotection by Antioxidants. </span><span class="c31 c41 c58 c71">Annals of the New York Academy of Sciences.</span><span class="c31 c58 c71"> 2000; 899: 44–60. doi:10.1111/j.1749-6632.2000.tb06175.x)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Also looked at current other methods of radioprotection (doubles as market research for the application of our device) </span><span class="c31 c100">(</span><span class="c31 c100 c71">Kamran, M. Z., Ranjan, A., Kaur, N., Sur, S. and Tandon, V. (2016), Radioprotective Agents: Strategies and Translational Advances. Med. Res. Rev., 36: 461–493. doi:10.1002/med.21386)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Currently some radioprotectors have been proposed for cancer radiotherapy (ex. synthetic thiol-containing compounts, amifostine) but uptake by the public and medical community has not been great as side-effects were undesirable and drug benefits were not well defined</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">NASA Biocapsule - we did not know about this the time when we came up with our project, but after some searching around we stumbled apon this on the internet. Comparable technology to our device, unsure about the progress/research that has been done on this as NASA is very secretive </span><span class="c31 c58">(</span><span class="c31 c58 c54"><a class="c56" href="https://www.google.com/url?q=http://sservi.nasa.gov/articles/nasa-breakthrough-could-save-millions-lives/&sa=D&ust=1475978704054000&usg=AFQjCNEYEUl-XLVcCFF6d8XapQtlreVlVg">http://sservi.nasa.gov/articles/nasa-breakthrough-could-save-millions-lives/</a></span><span class="c31 c58">; </span><span class="c31 c58 c54"><a class="c56" href="https://www.google.com/url?q=http://www.medgadget.com/2012/02/nasa-biocapsule-implant-diagnoses-and-treats-diseases-without-human-intervention.html&sa=D&ust=1475978704055000&usg=AFQjCNFbVdoi9CgkZak8aGB7fkUMUj7tjw">http://www.medgadget.com/2012/02/nasa-biocapsule-implant-diagnoses-and-treats-diseases-without-human-intervention.html</a></span><span class="c31 c58"> )</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Were unsure about the specific potential application of our peptide: it was a debate between cancer radiation prevention (as radiotherapy is known to cause secondary cancers, and certain existing literature stated that BBI has radioprotective effects only on p53+ cells, which about 60% of all cancers are p53-) </span><span class="c31 c58">(</span><span class="c31 c58 c71">Dittmann KH, Gueven N, Mayer C, Ohneseit P, Zell R, Begg AC, Rodemann HP. The presence of wild-type TP53 is necessary for the radioprotective effect of the Bowman-Birk proteinase inhibitor in normal fibroblasts. Radiation Research. 1998;150:648–655.)</span><span class="c22">, or space application</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">We realize these applications would call for very different designs for our device as well as different methods of testing, but those differences exist mostly in the more refined details of our project, which would not affect our preliminary work</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Decided that we needed a deadline by which to decide the application of our project: End of June (tentative)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Planned out some experiments we wanted to do to test viability of the various peptides: Clonogenic survival assay with both cancer cells as well as primary cells</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-1 start">
| |
| − | <li class="c19 c11"><span class="c22">We had a few variations on the clonogenic survival: thought about doing high throughput assays with 96 well plates, dual plating with cancer and primary cells to see interactions, comparison of survivability of cancers vs. primary cells with and without BBI treatment</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_1-0">
| |
| − | <li class="c62 c11"><span class="c22">Expected results: BBI is expected to protect our primary cells against radiation while not protecting our cancer cells as much as the primary cells. Meaning that the surviving fractions of our cell lines treated with BBI will be higher than that of cell lines not treated with BBI, and the surviving fractions of primary cell lines treated with BBI will be higher than that of cancer cell lines treated with BBI</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24 c63"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">May 3, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">Dr. Goodarzi Interview</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_2-0 start">
| |
| − | <li class="c62 c11"><span class="c22">We met with Dr. Goodarzi to talk about potential assays and our prospects for the summer</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Dr. Goodarzi confirmed the viability of our clonogenic survival assay in testing the effectiveness of BBI and mBBI, but he also suggested a few more assays we can use, namingly the H2AX assay </span><span class="c31 c58">(</span><span class="c31 c58 c71">Mariotti LG, Pirovano G, Savage KI, Ghita M, Ottolenghi A, Prise KM, et al. (2013) Use of the γ-H2AX Assay to Investigate DNA Repair Dynamics Following Multiple Radiation Exposures. PLoS ONE 8(11): e79541. doi:10.1371/journal.pone.0079541) </span><span class="c22">and the Flow cytometry assay</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_2-1 start">
| |
| − | <li class="c19 c11"><span class="c22">H2AX: Can use fluorescent tags to tag H2AX foci (histone proteins that localize around double stranded breaks) to detect the number of double stranded breaks post irradiation with or without BBI. Using fluorescent microscopy to view double stranded breaks post irradiation, we can blind count the number of detected foci at various timepoints within 24 hours of irradiation to see if the cells treated with BBI are able to repair their double stranded breaks (marked by the decrease of fluorescent foci) at a faster rate comared to cells that are not</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_2-0">
| |
| − | <li class="c62 c11"><span class="c22">Dr. Goodarzi had also suggested that we use non-cancer cell lines as well as cancerous cell lines to test the difference in radiation protection in cancer cells versus non-cancerous cell lines</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Listed a number of cell lines that will be able to provided for us, including a variety of cancerous cell lines as well as normal cell lines</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24 c63"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">May 4, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">Laboratory introduction and techniques week</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_3-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Made and Autoclaved agar (1L)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_3-1 start">
| |
| − | <li class="c19 c11"><span class="c22">1% tryptone (10g)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">0.5% Yeast extract (5g)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">1% NaCl (10g)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">1.5% Agarose (15g)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_3-0">
| |
| − | <li class="c62 c11"><span class="c22">Poured plates of LB agar with 3 different types of antibiotics:</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_3-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Amp (stock 100 mg/mL; final 100 ug/mL)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Kan (stock 50 mg/mL; final 50 ug/mL)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Chlor (stock 50 mg/mL; final 30 ug/mL)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">May 5, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">Laboratory introduction and techniques week</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_4-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Results: </span><span class="c31 c49">Cultured competent E.Coli as well as Chlor-resistant E.Coli on each type of Agar plate(s)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_4-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Growth of a lawn of red-coloured bacteria (Chlor-resistant culture on Chlor plate & Chlor-resistant culture on Amp plate)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Growth of a lawn of white/yellow- coloured bacteria (competent E.Coli culture on Amp plate) --> contamination (?)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">No growth observed on other plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_4-0">
| |
| − | <li class="c62 c11"><span class="c22">Results: </span><span class="c31 c49">Liquid Culture of normal as well as Chlor-resistant E.Coli (no antibiotic added to liquid culture)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_4-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Growth of white/yellow bacterial cultures on the bottom of all tubes</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_4-0">
| |
| − | <li class="c62 c11"><span class="c22">Made 50mM CaCl</span><span class="c68 c46">2</span><span class="c22"> (5mL of 1M CaCl</span><span class="c68 c46">2</span><span class="c22">, 95mL ddH</span><span class="c68 c46">2</span><span class="c22">O) & 50mM CaCl</span><span class="c46 c68">2</span><span class="c22"> with 15% Glycerol (5mL 1M CaCl</span><span class="c68 c46">2</span><span class="c22">, 15mL Glycerol, 80mL ddH</span><span class="c68 c46">2</span><span class="c22">O) for making competent E.Coli --> placed in 4°C fridge</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_5-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Inoculated 2 tubes of 5 mL LB with old (#10) competent </span><span class="c22 c41">E. coli </span><span class="c22">cells</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Inoculated 2 tubes of 5 mL LB with new (C3037) competent </span><span class="c22 c41">E. coli </span><span class="c22">cells (Used steril 5 mL LB as negative control) --> incubated at 37</span><span class="c31 c64">°</span><span class="c22">C O/N, shaking (200 rpm)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">May 6, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">Laboratory introduction and techniques week</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_6-0 start">
| |
| − | <li class="c62 c11"><span class="c22">The overnight cultures of competent </span><span class="c22 c41">E. Coli</span><span class="c22"> (#10 and C3037) were subcultured in 49ml of LB. There were four subcultures total: 2xC3037 and 2x#10. Cultures were incubated at 37.5°C and shaken at 200rpm for 4 hours. The cultures were grown to an optical density of 0.647 (within the range of 0.4-0.6)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_7-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Chemical comptenece</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_7-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Cultures were spun down for 7 minutes at 3000rpm and 4°C</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">12.5ml of cold 50mM CaCl</span><span class="c68 c46">2</span><span class="c22"> was added and the pellet resuspended</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Cells were then incubated on ice for 10 minutes</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Cells were spun down again at 1500rpm for 2 minutes at 4°C</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Cells were resuspended in 2ml of 50mM CaCl</span><span class="c68 c46">2 </span><span class="c22">with 15% glycerol</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Transfer to microcentrifuge tube in 100μl aliquots</span>
| |
| − | </li>
| |
| − | <li class="c11 c19"><span class="c22">Storage at -80°C</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_7-0">
| |
| − | <li class="c11 c62"><span class="c22">The rest was left up to chassis team to document and discuss results</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">May 9, 2016: </span><span class="c23 c71 c46">EXPERIMENTAL GOALS FOR THE SUMMER - DISCUSSION</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">BBI Efficiency</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_8-1 start">
| |
| − | <li class="c19 c11"><span class="c22">test in human cell lines</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">requires positive/negative control</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c4">Cytotoxic treatment</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_8-1">
| |
| − | <li class="c19 c11"><span class="c22">induce DNA damage from something other than radiation/determination of mechanism</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">H2AX assay</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c4">Circuit Function</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_9-1 start">
| |
| − | <li class="c19 c11"><span class="c22">testing construct components</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">promoters and RBS</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">test with reporter genes</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">BBI expression</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">use mass spec/MALDI to measure peptide amount</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">use rtQ-PCR as a backup</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c4">Excretion (overlap with Chassis)</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_10-1 start">
| |
| − | <li class="c19 c11"><span class="c22">similar assay to BBI excretion</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">May 10, 2016</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_21-0 start">
| |
| − | <li class="c5"><span class="c9">Researched the demand for a radioprotective strategy in space exploration, found that NASA and the CSA are trying to further research efforts in this area, making it an important issue to address (</span><span class="c4 c71 c87"><a class="c56" href="https://www.google.com/url?q=http://www.space.com/21353-space-radiation-mars-mission-threat.html&sa=D&ust=1475978704087000&usg=AFQjCNFpY2zUSeROuMQE8aMyFx0JIOAVEw">http://www.space.com/21353-space-radiation-mars-mission-threat.html</a></span><span class="c9 c71 c46">)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c71 c46">Similar products are currently under development by NASA called the biocapsule (</span><span class="c4 c87 c71"><a class="c56" href="https://www.google.com/url?q=http://www.americaspace.com/?p%3D13700&sa=D&ust=1475978704088000&usg=AFQjCNEtuSyP-etuze8Eeq6rvmJlhYTbIg">http://www.americaspace.com/?p=13700</a></span><span class="c9 c71 c46">) </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_21-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c71 c46">The developments of the biocapsule technology is unknown in the public, so we do not know how similar the biocapsule is from our proposed project</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">May 11, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Peptide Sequences</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_22-0 start">
| |
| − | <li class="c25 c11 c92"><span class="c9">Compiled the mBBI amino acid sequences found in literature searches, and also put in some of our own additions to prime the peptide for secretion and delivery, as well as to accommodate our own assays</span>
| |
| − | </li>
| |
| − | <li class="c25 c92 c11"><span class="c9">Reverse translated them into genetic sequences for E.Coli as well as B. Subtilis</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.7d7b3586959b48f7f78d00c903a3205bbf179c2b"></a>
| |
| − | <a id="t.0"></a>
| |
| − | <table class="c33">
| |
| − | <tbody>
| |
| − | <tr class="c51">
| |
| − | <td class="c111" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c89 c87">Common Identifier</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c83" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c87 c108">FASTA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c110" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c103 c87">E. Coli</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c109" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c87 c89">B. Subtilis</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c106" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c87 c103">D. Radiodurans</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">(S) 9mer</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">CALSYPAQC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TGC-GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c88" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">UGC-GCC-CUG-AGC-UAC-CCC-GCC-CAG-UGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">(V) 9mer</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">CALVYPAQC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TGC-GCG-CTG-GTG-TAT-CCG-GCG-CAG-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TGC-GCA-CTG-GTT-TAT-CCG-GCA-CAA-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c61" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">UGC-GCC-CUG-GUG-UAC-CCC-GCC-CAG-UGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">(S) 7mer</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">ALSYPAQ</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c61" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GCC-CUG-AGC-UAC-CCC-GCC-CAG</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">BBI protein</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">SACKSCICALSYPAQCFCVDIT</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">UCC-GCG-UGC-AAA-UCC-UGC-AUU-UGC-GCG-CUG-UCC-UAU-CCG-GCG-CAG-UGC-UUU-UGC-GUG-GAU</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">TCA-GCA-TGC-AAA-TCA-TGC-ATT-TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC-TTT-TGC-GTT-GAT-ATT-ACA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c61" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c16"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">Peptide #1 BBI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">KSCICALSYPAQCF</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAA-AGC-TGC-ATT-TGC-GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC-TTT</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAA-TCA-TGC-ATT-TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC-TTT</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c88" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAG-AGC-UGC-AUC-UGC-GCC-CUG-AGC-UAC-CCC-GCC-CAG-UGC-UUC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">Peptide #2 - NLS</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GPKKKRKVKSCICALSYPAQCF</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCG-AAA-AAA-AAA-CGC-AAA-GTG-AAA-AGC-TGC-ATT-TGC-GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC-TTT</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCG-AAA-AAA-AAA-AGA-AAA-GTT-AAA-TCA-TGC-ATT-TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC-TTT</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c61" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCC-AAG-AAG-AAG-CGC-AAG-GUG-AAG-AGC-UGC-AUC-UGC-GCC-CUG-AGC-UAC-CCC-GCC-CAG-UGC-UUC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c51">
| |
| − | <td class="c60" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">Peptide #3 BBI HA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c50" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">KSCICALSYPAQCFYPYDVPDYA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c77" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAA-AGC-TGC-ATT-TGC-GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC-TTT-TAT-CCG-TAT-GAT-GTG-CCG-GAT-TAT-GCG</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c74" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAA-TCA-TGC-ATT-TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC-TTT-TAT-CCG-TAT-GAT-GTT-CCG-GAT-TAT-GCA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c61" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">AAG-AGC-UGC-AUC-UGC-GCC-CUG-AGC-UAC-CCC-GCC-CAG-UGC-UUC-UAC-CCC-UAC-GAC-GUG-CCC-GAC-UAC-GCC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c107" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">Peptide #4 BBI NLS-HA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c105" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GPKKKRKVKSCICALSYPAQCFYPYDVPDYA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c101" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCG-AAA-AAA-AAA-CGC-AAA-GTG-AAA-AGC-TGC-ATT-TGC-GCG-CTG-AGC-TAT-CCG-GCG-CAG-TGC-TTT-TAT-CCG-TAT-GAT-GTG-CCG-GAT-TAT-GCG</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c69" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCG-AAA-AAA-AAA-AGA-AAA-GTT-AAA-TCA-TGC-ATT-TGC-GCA-CTG-TCA-TAT-CCG-GCA-CAA-TGC-TTT-TAT-CCG-TAT-GAT-GTT-CCG-GAT-TAT-GCA</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c102" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c16">GGC-CCC-AAG-AAG-AAG-CGC-AAG-GUG-AAG-AGC-UGC-AUC-UGC-GCC-CUG-AGC-UAC-CCC-GCC-CAG-UGC-UUC-UAC-CCC-UAC-GAC-GUG-CCC-GAC-UAC-GCC</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">May 12, 2016</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_23-0 start">
| |
| − | <li class="c5"><span class="c9">Asked for peptide quotes from a multitude of peptide synthesis companies to find the cheapest and best synthesis deal</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c81"><br></span><span class="c23">May 14-15, 2016: Lethbridge Workshop</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Imagine, Design, Create – Cesar Rodriguez (cesar,.rodriguez@med.fsu.edu)</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_17-0 start">
| |
| − | <li class="c5"><span class="c9">imagine: Write it down!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_17-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Cell based therapeutics is the third pillar of medical therapeutics (small molecule </span><span class="c72">→</span><span class="c9"> proteins/antibiotics </span><span class="c72">→</span><span class="c9"> cells)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">If[molecule]>x THEM produce therapy (molecule</span><span class="c72">→</span><span class="c9">senser</span><span class="c72">→</span><span class="c9">procduct</span><span class="c72">→</span><span class="c9">activator</span><span class="c72">→</span><span class="c9">product)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Sense environment; produce effect (ex. Smell bread</span><span class="c72">→</span><span class="c9">salivate)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_17-0">
| |
| − | <li class="c5"><span class="c9">Design: design specification</span><span class="c72">→</span><span class="c9">simulation modification</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_17-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Apple omnigrapho </span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Microsoft visio</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Cell modeller</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Jupyter (anaconda package)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Neuvidiaflex</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_17-0">
| |
| − | <li class="c5"><span class="c9">Create: Make your prototype</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_17-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Gen9 (DNA synthesis company)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Twist (DNA synthesis)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Cloudlab (do your experiments in a remote lab)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31 c54">Policy & Practices in DIY Bio and iGEM – David Lloyd</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_18-0 start">
| |
| − | <li class="c5"><span class="c9">Core of HP: Society</span><span class="c72">←→</span><span class="c9"> Lab</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_18-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Social sciences based questions</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Follows a methodology</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Demonstrates real world application</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Meaningful impact on your labwork</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Discover things you didn’t know before</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_18-0">
| |
| − | <li class="c5"><span class="c9">Outreach </span><img src="https://static.igem.org/mediawiki/2016/1/14/T--UofC_Calgary--syedj0.jpg"><span class="c9"> P&P (outreach is put out; P&P is bring in)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Read the judge’s notebook on website COMMUNICATE! TARGET AUDIENCE!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_18-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Make it obvious how you fulfill the criteria</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Make sure you differentiate P&P vs. outreach</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_18-0">
| |
| − | <li class="c5"><span class="c9">Be careful of survey design!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_18-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">If you are doing a survey, make sure you make it statistically relevant</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Good example: Gender Study (Paris Bettencourt 2013)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31 c54">Mathematical Modelling for SynBio – Brian Ingals</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_19-0 start">
| |
| − | <li class="c5"><span class="c9">Physical vs. conceptual</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Mathematical modesl can be mechanistic (description) or predictive (make inferences/extrapolation)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Mass action kinetics</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_19-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Chemical rxn: X</span><span class="c72">→</span><span class="c9">P</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Rate constant: k=[P]/[X]</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Etc.</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_19-0">
| |
| − | <li class="c5"><span class="c9">Programs that can be used</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_19-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">COPASI</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">MATLAB</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">XPPAIIT</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Mathematica</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_19-0">
| |
| − | <li class="c5"><span class="c9">Separation of time scales; phase plane analysis</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_19-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Processes slow </span><span class="c72">→</span><span class="c9"> treated as frozen in time</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Processes fast </span><span class="c72">→</span><span class="c9"> treated as occurring instantaneously</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31 c54">Wiki & Visual Design in iGEM – Patrick Wu</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_20-0 start">
| |
| − | <li class="c5"><span class="c9">Design vs. Art (not the same thing)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_20-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Design: communicate the same thing to everyone (USABILITY is key!)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Art: Can have different interpretations to different people</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_20-0">
| |
| − | <li class="c5"><span class="c9">Content, accessibility, visual hierarchy, grid layout to organize info</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Interpret data for your audience! Figure captions and descriptions</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Summary page for judges is good for check-boxing</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c71 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c71 c46">May 16, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23 c46 c71"></span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_24-0 start">
| |
| − | <li class="c5"><span class="c9 c71 c46">Decided on BioBasic as our peptide synthesis company and ordered all of the peptides</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c71 c46">Ordered full length BBI as well as KTI (as a backup peptide) from Sigma Aldrich</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c71 c46">Wait for ~3 weeks for peptides to come!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">June 6, 2016</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_26-0 start">
| |
| − | <li class="c5"><span class="c9 c46">Dr. Goodarzi had suggested the idea of reducing our peptide; in the original structure of BBI, our truncated section contains 2 cysteines (which means the possibility of cysteine bridges) </span><span class="c9">(</span><span class="c9 c71 c46">Voss, R.-H., Ermler, U., Essen, L.-O., Wenzl, G., Kim, Y.-M. and Flecker, P. (1996), Crystal Structure of the Bifunctional Soybean Bowman-Birk Inhibitor at 0.28-nm Resolution. European Journal of Biochemistry, 242: 122–131.doi:10.1111/j.1432-1033.1996.0122r.x)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Literature supports that reduction of our peptide would not affect its radioprotective effects </span><span class="c9">(</span><span class="c9 c71 c46">Gueven N, Dittmann K, Mayer C, Rodemann HP. The radioprotective potential of the Bowman-Birk protease inhibitor is independent of its secondary structure. Cancer Letters. 1998;125:77–82.</span><span class="c9">)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">We chose to use DTT as our reducing agent from literature search</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 10, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenics 0.1 – cell splitting protocol</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_27-0 start">
| |
| − | <li class="c5"><span class="c9">take HTC116 cell line with >50% confluency</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">wash cell line twice with 1mL of DMSO</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 1mL 37C trypsin and incubate for 4 minutes</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 4mL of media (McCoy's with 10%FBS and 0.5%pen-strep) to each of 4 new plates</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 3mL media to plate from step 3 to quench trypsin, pipette up and down to separate the cells (ideally we have no clumps in the cells but have them individually suspended in solution</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 1mL of the cells from step 5 to each plate done in step 4, making sure to seed the cells all over the plate</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">incubate at 37C with 5% CO2 to use for next time (over the weekend)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 13, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1 – solvation of peptide</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_28-0 start">
| |
| − | <li class="c5"><span class="c9">dissolved our heptamer peptide (ALSYPAQ) in McCoy's Media, our peptide was not visible to the naked eye after adding McCoy's Media, so it's soluble(?). We then did a serial dilution with the peptide solution to make varying concentrations</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.34648293ec7ea8e193da5824ed9c3d0756cba559"></a>
| |
| − | <a id="t.1"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c95" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">concentration</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c82" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">volume of peptide solution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c36" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">volume of media</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c90" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">total volume</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c95" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1200μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c82" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">dry peptide</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c36" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">10mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c90" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">10mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c95" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">150μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c82" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1mL from 1200μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c36" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">7mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c90" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">8mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c95" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">100μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c82" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4mL from 150μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c36" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c90" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">6mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c95" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">50μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c82" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2mL from 100μM</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c36" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c90" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31">We got scolded... </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31">** Remember for next time/actual experiment: only 2-10</span><span class="c31 c49">μL of drug/peptide treatment (negligable amounts) should be added to cell lines to do experiment instead of incorporating the peptide into our media</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1 – Cell counting and seeding protocol</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_28-0">
| |
| − | <li class="c5"><span class="c9">a ~50% confluent cell line of HCT116 cells</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">removed media, washed twice with 25°C DPBS</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 1mL of 37°C trypsin, incubated for 6min in 37C, 5% CO2 incubator</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">quench effects of trypsin by adding 3mL media (McCoy's Media with 10% FBS and Pen-Strep) pipetted up and down to suspend cells </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">put 4mL of solution containing cells into autoclaved 15mL falcon tube and centrifuged at 2500rpm for 5min at 25C</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">removed all media, leaving only pellet of cell</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">resuspended cells with 1mL media (removed 50μL to look at under the microscope to make sure clumping of cells is minimal)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">pipette 10</span><span class="c9 c49">μL of cell mixture and mixed with 10μL of typan blue; pipetted onto cell counting slide (10μL in each of well A and B)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">put the slide in cell counter:</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_28-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Well A: live cells 9.15x10</span><span class="c9 c70">5 </span><span class="c9">cells/mL (69% live cells)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Well B: live cells 7.04x10</span><span class="c9 c70">5</span><span class="c9"> cells/mL (81% live cells)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_29-0 start">
| |
| − | <li class="c5"><span class="c9">The discrepancy between the two wells is quite big, meaning that we did not mix the cell mixture well before counting. Ideally we would want to work with cell cultures that are 85-100% live cells, so we should be careful of cell death (leaving trypsin on for less time, more cogniscent of bubbles etc) in coming experiments. </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">But for the sake of practice we decided to seed the cells from the cell counting experiment (average of well A&B: 809500 cells/mL) by plating 6 plates of each of the following cell counts:</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.ca1372b202294f52441627010e2f7853e8500702"></a>
| |
| − | <a id="t.2"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c66" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">cell count/mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c59" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">cell solution volume</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c97" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">media volume</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c73" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">total volume</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c66" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c59" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">37μL from 809500cell/mL solution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c97" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">15mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c73" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">~15mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c66" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c59" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">6mL from 2000cell/mL solution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c97" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">6mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c73" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">12mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c66" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c59" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4mL from 1000cell/mL solution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c97" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c73" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">8mL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <ul class="c30 lst-kix_list_30-0 start">
| |
| − | <li class="c5"><span class="c9">1mL of each solution was added to 4mL media on the plates. (6 plates for each cell count)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">the plates were incubated at 37C and 5% CO2 (will check up on them Friday) OUR CANCER BABIES!!!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23"> June 14, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 1.0 </span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_31-0 start">
| |
| − | <li class="c5"><span class="c9">BBI Treatment of HCT116 Cells - 7mer (ALSYPAQ)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_31-1 start">
| |
| − | <li class="c19 c11 c25"><span class="c9">Time of Application: 10:55 AM</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Time of Irradiation: 4:10PM</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31">**Plates were treated with BBI by Sid** (see put peptide in solution entry from Monday 6/13)</span>
| |
| − | </p>
| |
| − | <a id="t.ae0dede83765d4e50ac7dcbb254bf19f61f13ea2"></a>
| |
| − | <a id="t.3"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c75" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">Plate #</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c91" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">Cell Density</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c94" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">BBI Concentration</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c96" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">IR Dosage</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c75" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1-6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c91" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">500 cells</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c94" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c96" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">0 Gy</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c75" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1-3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c91" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1000 cells</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c94" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">10 microMolar</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c96" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">5 Gy</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c75" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4-6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c91" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1000 Cells</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c94" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">30 microMolar</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c96" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">5 Gy</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c75" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1-6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c91" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2000 cells</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c94" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c96" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">5 Gy</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 15, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_32-0 start">
| |
| − | <li class="c5"><span class="c9">Made 500mL fix solution (3% acetic acid, 8% methanol, 89% water)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">stain solution (0.2% crystal violet, 10% formalin in PBS)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_32-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c49">could not find formalin to make stain solution, we will get some from Nick Jette, but in the meantime we ordered some</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 16, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_33-0 start">
| |
| − | <li class="c5"><span class="c9">Some of our stock cells look very overgrown, so we split some of the less confluent ones, and we are going to throw away the ones that are more overgrown</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 347.27px; height: 463.03px;"><img alt="Macintosh HD:Users:sora:Downloads:overconfluent_cells (1).jpg" src="https://static.igem.org/mediawiki/2016/4/47/T--UofC_Calgary--syedj7.jpg" style="width: 347.27px; height: 463.03px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_33-0">
| |
| − | <li class="c5"><span class="c9">Looked at the cells we decided to irradiate and treat. The 1000 plates (treated with BBI and irradiation) looked very strange under the microscope as it had little specks that were not our cells. We suspect it is because our peptides were not soluble in McCoys media and clumped up in solution. So we will try to dissolve the other peptides in DMSO first before applying to our cell cultures. In the meantime, we are trying to salvage our heptamer by centriguging to see if the peptides will form a pellet so that we can test a few more things on it before we toss it out. </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 360.00px; height: 480.00px;"><img alt="Macintosh HD:Users:sora:Downloads:1000_plate_peptide_clumps (1).jpg" src="https://static.igem.org/mediawiki/2016/2/2d/T--UofC_Calgary--syedj9.jpg" style="width: 360.00px; height: 480.00px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 17, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1 – Fixing and Staining protocol</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_33-0">
| |
| − | <li class="c5"><span class="c9">Our staining solution (06/15 entry) was not up to par to the standards as it did not look dark enough. The suspicion is that our crystal violet was not a the right concentration to begin with (as our crystal violet came in solution form instead of powder form), so we will go back and search up the initial concentration of our crystal violet. In the mean time, this practice will be done with crystal violet provided to us by the Susan-Lees Millers lab. </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Media was removed from plates</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">1mL fix solution was added (see entry on June 15); let sit for 2 min, then removed</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">1mL stain solution was added (see entry on June 15); let sit for 5 min, then removed</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">deionized water was added to each plate (covers surface of the plate) to rinse the cells, removed</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_34-0 start">
| |
| − | <li class="c5"><span class="c9">looked at stained colonies</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_34-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">the 500 plates had more colonies than the other 2 types of plates</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">1000 plates had very little to no colonies</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">2000 plates had about the same amount of colonies than 500 plates, but the colony sizes are much smaller</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23"> June 20, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.2</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_36-0 start">
| |
| − | <li class="c5"><span class="c9">before we start to do our official trials, we needed to do another practice to familiarize ourselves with techniques</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_35-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Learned that the P1000 pipettes were very effective in breaking up cells</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_37-0 start">
| |
| − | <li class="c5"><span class="c9">counted and seeded 48 plates with varying cell counts (x6 plates for each manipulation)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.725d38493444b56007d78d0dd0991c1c22794a9e"></a>
| |
| − | <a id="t.4"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c80" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">Drug (DMSO) Treatment Volume</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c21" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">0Gy Radiation</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c44" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">5Gy Radiation</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c80" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">0μL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c21" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c44" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 2000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c80" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">3μL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c21" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c44" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c80" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">6μL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c21" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c44" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c80" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">9μL</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c21" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c44" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">sd. 1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 21, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.2</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_37-0">
| |
| − | <li class="c5"><span class="c9">Treated cells with varying volumes (Table15) of filter-sterilized DMSO as a carrier control as well as irradiated all our plates. </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Now to just wait for our babies to grow in the incubator!</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.2 - For Thursday (10AM)</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_38-0 start">
| |
| − | <li class="c5"><span class="c9">More cell count and seeding practice</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">counting practice plates from last friday in the cell colony counter and doing statistics on them</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">setting up the vacuum media aspirator (maybe)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 23, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.1 - Colony Counting Protocol </span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_39-0 start">
| |
| − | <li class="c5"><span class="c9">Open the computer, select Colcount and the password is dnapk*atm</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Once on the desktop screen select colcount from the desktop</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Once the application opens click start, select 50mm UpperPosition (7E2) and then click Load</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Select Cell present and hit browse - use either Nick(good) or small colonies </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Insert the blank with no tip and it will start warming up.</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Optional - Save at desktop and make new folder every day</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Grab the plates with colony and start counting </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c23">Happy Counting </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <a id="t.363d508e5404361def02781aea4dbe668992ff1b"></a>
| |
| − | <a id="t.5"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">Plates</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">46</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">22</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">84</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">63</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">22</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">53</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">42</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">19</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c67" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c53" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">43</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c35" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c84" colspan="1" rowspan="1">
| |
| − | <p class="c11 c13"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 27, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Clonogenic 0.2</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_40-0 start">
| |
| − | <li class="c5"><span class="c9">Cells were trypsinized and counted using the Bio-Rad counter and plates. </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_40-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Well A: 1.17 x 10</span><span class="c9 c70">7</span><span class="c9"> cells/ml (76% alive)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_40-0">
| |
| − | <li class="c5"><span class="c9">36 x 1000 cell plates and 36 x 500 cell plates were seeded with their respective amount of cells. 1ml of cell culture was added to 4 ml of McCoy's media with FBS and Pen-Strep. </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 576.00px; height: 429.07px;"><img alt="Macintosh HD:Users:sora:Downloads:Cancer_babies_looking_cute (1).JPG" src="https://static.igem.org/mediawiki/2016/f/f7/T--UofC_Calgary--syedj8.jpg" style="width: 576.00px; height: 429.07px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">June 29, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_41-0 start">
| |
| − | <li class="c5"><span class="c9">Our phosphorylated BBI peptide as well as our control scramble peptide came in! </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">We tried to seed our 168 plates today (see google docs clonogenics trial 1), but in our cell count, it turns out only 12-14% of our cells are alive??! (even though we redid it 3 times)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_41-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">we suspect that the cell counter was acting up as non of the other people's samples were working either. But either way those results are unusable, so we will have to push this off till next Monday to seed as this Friday will be Canada Day. </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 4, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_42-0 start">
| |
| − | <li class="c5"><span class="c9">Used stock cell plate with cells split on June 29th, also tried counting with cells from 2 weeks ago with 1000 seed but decided not to use them because cell survival was 9%</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Cell survival percentage of the stock solution used is average of 53%, decided to go ahead with the trials as we suspect it is our cell counting protocol that needed tweaking as opposed to our cells actually being fifty percent dead</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_42-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Seeded 100 plates with 500 cells/plate</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">seeded 100 plates with 1000 cells/plate</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 5, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_43-0 start">
| |
| − | <li class="c5"><span class="c9">Plan of our clonogenics trial</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.332ebe585fcc931ada99c81967c6702a76803d02"></a>
| |
| − | <a id="t.6"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">plates #</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Volume added (uL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Radiation(Gy)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Seeding</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17"># Plates</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Time drugged</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Time irradiated</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Control (DMSO+DTT)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:28</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:52</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:32</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:42</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:28</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:42</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">9mer (S)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:32</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:35</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:40</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:32</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:02</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:35</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:40</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:05</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">KSCI BBI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:45</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:46</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:48</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:50</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:45</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:52</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:46</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:36</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:48</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:02</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:50</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:36</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Big BBI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:00</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:02</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">18</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:05</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">27</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:08</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:00</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:02</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:19</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">18</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:05</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">27</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12:08</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:19</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">KTI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:09</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">24</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">36</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:14</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:23</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:17</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">24</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:05</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">36</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">Scramble</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:29</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:32</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:33</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:56</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:37</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:40</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:27</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:41</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:47</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c17">P-Tyrosine 9mer (S)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:52</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:50</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:48</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:56</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:55</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:57</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6:10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c32" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c28" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c26" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c12" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c42" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11:59</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c40" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5:47</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 12, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_43-0">
| |
| − | <li class="c5"><span class="c9">the cultures with p(y) 9mer looks more yellow than other plates, perhaps indicating more colonies (more to come in 2 weeks)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 15, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_43-0">
| |
| − | <li class="c5"><span class="c9">We had set up a vacuum to suck off the media as well as treat our plates with fix and stain solution. Colonies were counted using ColCount colony counter.</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <a id="t.4ffcfbd1a719bd12a18fc337a643a6781afc0498"></a>
| |
| − | <a id="t.7"></a>
| |
| − | <table class="c47">
| |
| − | <tbody>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Concentration (μmol/L)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Radiation(Gy)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Seeding</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c99" colspan="3" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Colony Count</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Treatment Concentration</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Surviving Fraction</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Trial PE</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Control (DMSO+DTT)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">200</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">168</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.955085482</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c23 c98">0.431375</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">178</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">242</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">215</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.98135806</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">237</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">311</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">220</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.186902347</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">223</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">270</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.148266203</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">16</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">24</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">15</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.042499759</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">37*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">18</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.041727036</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">31*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">16</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.027818024</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">28</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.041727036</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">9mer (S)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">208</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">220</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.992176181</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">77</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">191</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">180</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.692359703</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">122</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">129</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">120</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.573360379</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">106</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">117</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">140</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.560996813</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.031681638</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">17</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">27</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.057181493</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">22</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">7</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.024727132</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">26</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.037090698</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">KSCI BBI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">194</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">221</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">209</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.964358157</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">212</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">209</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">218</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.987539844</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">247</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">268</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">242</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.169902444</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">227</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">201</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">199</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.968994494</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">48*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">66*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">50*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">23</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">6</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.032454361</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">17</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.025499855</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">85*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.025499855</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Big BBI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">184</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">202</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">204</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.911813001</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">198</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">211</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.018448759</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">256</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">236</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.140538974</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">225</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">290</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">246</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.176084227</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">19</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">48*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">11</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.03477253</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">22</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">15</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">28</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.050226987</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">18</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">23</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.039408867</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">50</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">28</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.076499565</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">KTI</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">247</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">267</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.180720564</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">251</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">286</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">241</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.202356805</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">222</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">236</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">232</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.066357578</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">198</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">240</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">206</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.995267072</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">22</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">43*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.05099971</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">79*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.048681542</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">83*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">33*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.023181686</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">27</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">42</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.076499565</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">Scramble</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">218</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">227</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">243</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.063266686</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">278</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">283</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">335</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.384719405</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">271</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">284</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">252</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.247174732</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">248</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">295</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">240</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.210084034</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">17</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">31</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.044045204</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">33</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">31</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.068772337</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">36</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">53</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.103158505</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.035545253</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c17">P-Tyrosine 9mer (S)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">241</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">216</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">235</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1.069448469</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">180</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">226</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">176</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.899449435</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">107</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">126</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">131</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.562542258</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">107</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">108</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">123</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.522360668</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">14</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.027818024</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">13</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">19</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.037090698</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">51*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c1">51*</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c3">
| |
| − | <td class="c43" colspan="1" rowspan="1">
| |
| − | <p class="c6"><span class="c17"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c45" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c10" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">1000</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">37</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">8</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c0" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">12</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c8" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c18" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c1">0.044045204</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c34" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11 c24"><span class="c1"></span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <p class="c11"><span class="c31">>blank spaces indicates the plates were contaminated in the process of obtaining the data, as such data was not obtained and these plates were excluded from counting.</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenic 1.0 - Graphs</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_43-0">
| |
| − | <li class="c5"><span class="c9">Graph 1 is of plates seeded with just 500 cells and treated with just variuos peptides and no radiation to see if peptides inherently have toxicity to our cells. Data was created in excel with different treatments overlayed on top of one another. Error bars represent excel calculated standard error for those particular data points. </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Graph 2 is of plates seeded with 1000 cells and treated with various peptides as well as 5Gy radiation to see if our peptides confer radioprotection to our cells. </span><span class="c9 c49">Data was created in excel with different treatments overlayed on top of one another. Error bars represent excel calculated standard error for those particular data points. (note the scale difference between the two graphs)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 571.67px; height: 320.00px;"><img alt="Macintosh HD:Users:sora:Downloads:clipboard_2016-07-20_173450.png" src="https://static.igem.org/mediawiki/2016/4/48/T--UofC_Calgary--syedj11.jpg" style="width: 571.67px; height: 320.00px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 576.00px; height: 336.00px;"><img alt="Macintosh HD:Users:sora:Downloads:clipboard_2016-07-20_173517.png" src="https://2016.igem.org/File:T--UofC_Calgary--syedj10.jpg" style="width: 576.00px; height: 336.00px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 18, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Clonogenics 1.0 - Discussion</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_44-0 start">
| |
| − | <li class="c5"><span class="c9">None of the peptides we intended to test showed significant radioprotection compared to out control with just DMSO and DTT (the solvent we dissolved our peptide in)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">BBI and KTI were interesting in that at 30μmol/L they seem to be conferring radioprotection to our cell-line compared to the control; but this relationship does not seem linear (no apparent linear correlation between application of the peptide and surviving fraction). Also cannot be sure of the significance of this observation due to the small increase that is apparent (being concious of the scale on the second graph)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">our scramble peptide seemed to increase the surviving fraction of irradiated cells <20μmol/L, but at 30</span><span class="c9 c49">μmol/L seemed to do nothing to help the surviving fraction of our cell-line. Only 2 datapoints were used in the calculation of the surviving fraction of cells treated with 20μmol/L scramble peptide so the error on this observation could be large--> requires more in-depth statistical analysis before conclusions. </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">The Serine 9mer as well as the p(Y)9mer seemed to be killing our cells/making them unable to reproduce, suggesting toxicity against HCT116 cells or cancer cells in general; while the rest of our peptides were comparable to the control treatement in terms of toxicity (or lack thereof)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">KTI protein as well as our scramble peptide showed interesting results on cells that did not undergo irradiation, in that those peptides seem to increase the surviving fraction on our cell-line</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">Next steps: Trypan Blue Assay Protocol</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_45-0 start">
| |
| − | <li class="c5"><span class="c9">Discussed next steps with our mentors and decided to do a Trypan Blue survivability assay in the interest of time. Trypan Blue Assay should be able to give us some analyzable results in the time-frame of a week</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_45-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Grow, treat and irradiate the cell line as needed to test timing as well as different peptides (splitting cells without being concious of the number seeding)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Aspirate the media and place it in an autoclaved 15mL falcon tube </span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">wash cells iwth DPBS and Trypsinize to lift cells off the plate, quench, then pipette the solution into the same 15mL falcon tube</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Mix well and stain with trypan blue stain.</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">Quickly count total cells and live cell fraction with BioRad 500 cell counter. Record percentage of live cells and tabulate for analysis of survivability.</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11"><span class="c31"> </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">July 20, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">HCT116 Trypan Blue 1.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_46-0 start">
| |
| − | <li class="c5"><span class="c9">attempeted to count cells for trypan blue assay, but after trypsinizing for longer than usual (8min), the cells at the botom of the plate was unwilling to lift off the plate when viewed under a microscope. Seemed like there was a carpet of other smaller material around the cells that is trapping the cells to the bottom of the 60mm plate. Media was normal and was not cloudy (which is why we were unsure about what to think.</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Consulted this observation with our advisor, who announced that it was likely contamination. As a result all plates were discarded (all plates seemed to see the same situation) and the incubator was cleaned out as the water in the incubator was getting gross (which might have been the source of the contamination to begin with)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Our HCT116 stock cells do not seem to be affected </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24 c78"><span class="c31"></span>
| |
| − | </p>
| |
| − | <p class="c11" id="h.gjdgxs"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 503.27px; height: 374.89px;"><img alt="Macintosh HD:Users:sora:Downloads:TrypanBlue_10x.JPG" src="https://static.igem.org/mediawiki/2016/c/cf/T--UofC_Calgary--syedj13.jpg" style="width: 503.27px; height: 374.89px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 505.74px; height: 376.73px;"><img alt="Macintosh HD:Users:sora:Downloads:TrypanBlue_40x (1).JPG" src="https://static.igem.org/mediawiki/2016/c/cf/T--UofC_Calgary--syedj12.jpg" style="width: 505.74px; height: 376.73px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px);" title=""></span>
| |
| − | </p>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">August 2, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">1BR3 Clonogenic 1.0 – Splitting protocol</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_47-0 start">
| |
| − | <li class="c5"><span class="c9">New Materials</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_47-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9">Media was composed of MEM (no extraneous nutrients), 15% FBS, 1% Penstrep, 2mM L-Glutamine (Stock is 200mM or 100x)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">used 0.25% trypsin</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9">used DPBS with no additives</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ol class="c30 lst-kix_list_48-0 start" start="1">
| |
| − | <li class="c5"><span class="c9">Fibroblasts were looked at under the microscope to ensure over 70% confluency</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">Aseptic technique practiced to a tee (turn on hood 15 min before using, warm up media and trypsin in the 37c water bath, spray and wipe down everything with ethanol, ensure we have sterile/autoclaved 15mL falcon tubes)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">wash 2 times with DPBS (making sure to pipette PBS on the side of the flask away from our cells)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 3ml trypsin in each flask, incubate at 37c for ~5min</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">bump side of flask to ensure all cells are rounded and deadhered (check under the microscope)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add media to quench trypsin effects (around 6mL)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">pipette media around the flask to "wash" down the surface (making sure declumped and deadhered)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">remove all media and place in a 15mL falcon tube</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">centrifuge tubes at 2500rpm, 4c, for 3 minutes; make sure there is a pellet (should be visible for a T75 flask)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">while the tubes are being centrifuged, fill new flasks with 14-18mL of media (T75 flasks)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">remove the falcon tubes from centrifuge, aspirate the media</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">resuspend cells in 6mL media (for a 1:3 split) or 8mL media (1:4 split)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">add 2mL into each new flask</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">tilt back and forth for an even spread</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9">place back into incubator and do not touch the cells again (to not disturb) until you need to use them next</span>
| |
| − | </li>
| |
| − | </ol>
| |
| − | <p class="c11 c24"><span></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 5, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_25-0 start">
| |
| − | <li class="c5"><span class="c9 c46">Trypsinized/ Lifted a T75 flask of 1BR3 feeder fibroblasts(passage #: 12; 80% confluency) and added to 10mL of media</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Irradiated cells at 35 Gy of radiation (</span><span class="c9 c70 c46">134</span><span class="c9 c46">Cs source, 85 Gy/min)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Diluted cells to make 110mL of cell solution</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Seeded a layer of feeder cells on 108x60mm plates by pipetting 3mL of media and 1mL of seeder cells</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Placed in 37</span><img src="images/image00.png"><span class="c9 c46">C, 5% CO2 overnight</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c4"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 6, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_12-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Counted 1BR3 cells from our T25 flask stock</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Well A: 5.98x10</span><span class="c22 c70">5</span><span class="c22"> (52% live); Well B: 6.41x10</span><span class="c22 c70">5</span><span class="c22">(48% live)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-0">
| |
| − | <li class="c62 c11"><span class="c22">Dilution and seeding of live 1BR3 cells to feeder plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 7, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.1</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Treatment with various peptides (big BBI, 9mer, p(Y) 9mer, KTI, DTT+DMSO, no treatment control) </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Peptides were added to a final concentration of 20uM</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Irradiation with 3 Gy of radiation according to original plan and seeding</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Placed in Placed in 37</span><img src="images/image00.png"><span class="c9 c46">C, 5% CO2</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 11, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.1 – Contamination</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_47-0">
| |
| − | <li class="c5"><span class="c9 c46">Found our stock flasks are contaminated</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Cleaned out our incubator and streaked reagents (media, DPBS, contaminated plate) on some LB plates to see what is causing the contamination</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Obtained more cells from Dr. Goodarzi – will be able to receive them in the near future</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c4"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 12, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Colonogenic 1.1 – Contamination results</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_49-0 start">
| |
| − | <li class="c5"><span class="c9 c46">Non of our reagents were found to be contaminated through streaking on LB</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Thought about the possibility of our trypsin being contaminated but eliminated the possibility as trypsin is a protease and cell should not grow there</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Contamination most likely due to incubator not being clean, so we thermal cycled our original incubator, and in the meantime we have switched to using a different incubator to avoid further contamination</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 15, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">Big Team meeting</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_50-0 start">
| |
| − | <li class="c5"><span class="c9 c46">Presented biotarget results to the whole team and all of our advisors</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Dr. Goodarzi, after seeing our presentation, gave us some suggestions on what to do going forward</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_50-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Suggested using lower Gy (ex. 0.25, 0.5, 1.0) to test for hyper-radiosensitivity that is observed at low Gy </span><span class="c72 c46">→</span><span class="c9 c46"> more applicable to project as typically astronauts receive radiation in 0.25 Gy range </span><span class="c9 c39">(</span><span class="c9 c39 c54"><a class="c56" href="https://www.google.com/url?q=https://www.scopus.com/authid/detail.uri?origin%3Dresultslist%26authorId%3D7102838197%26zone%3D&sa=D&ust=1475978705139000&usg=AFQjCNGXvRj480B2eBCeFNQDEm8u8joY9A">Short S.C.</a></span><span class="c9 c39">, </span><span class="c9 c39 c54"><a class="c56" href="https://www.google.com/url?q=https://www.scopus.com/authid/detail.uri?origin%3Dresultslist%26authorId%3D6701542705%26zone%3D&sa=D&ust=1475978705139000&usg=AFQjCNFsSsPvT_4-XoSpcqo_Xgy-jxIMlg">Woodcock M.</a></span><span class="c9 c39">, </span><span class="c9 c39 c54"><a class="c56" href="https://www.google.com/url?q=https://www.scopus.com/authid/detail.uri?origin%3Dresultslist%26authorId%3D35722523700%26zone%3D&sa=D&ust=1475978705140000&usg=AFQjCNEb73nhLSFn4W_DE6uF2PoZbMNBKw">Marples B.</a></span><span class="c9 c39">, 2003. </span><span class="c9 c39 c54"><a class="c56" href="https://www.google.com/url?q=https://www.scopus.com/authid/detail.uri?origin%3Dresultslist%26authorId%3D35516922800%26zone%3D&sa=D&ust=1475978705140000&usg=AFQjCNGWGc8405-CQ1fSXXV98LlmGQJCpw">Joiner M.C.</a></span><span class="c9 c39 c76"> </span><span class="c9 c39 c54"><a class="c56" href="https://www.google.com/url?q=https://www.scopus.com/record/display.uri?eid%3D2-s2.0-0037317397%26origin%3Dresultslist%26sort%3Dplf-f%26cite%3D2-s2.0-0037317397%26src%3Ds%26imp%3Dt%26sid%3D8A9125B90367424A3760C55BE3CB700E.WXhD7YyTQ6A7Pvk9AlA%253a20%26sot%3Dcite%26sdt%3Da%26sl%3D0%26recordRank%3D&sa=D&ust=1475978705141000&usg=AFQjCNFbxY8OLb_-6fecxal0-ru_0pI7mg">Effects of cell cycle phase on low-dose hyper-radiosensitivity</a></span><span class="c9 c39"> International Journal of Radiation Biology, 79 (2) , pp. 99-105.)</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Suggested altering the concentration of peptide added to our H2AX assay to see the effects of altering concentration on DSB repair</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Suggested looking at more timepoints after radiation for H2AX assay to get a better trend of looking at when BBI works on our cells</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Will be providing more 1BR3 cells for us to work with; Interested in looking at a comparison of how our peptides work in cancer cells vs. primary fibroblasts</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 18,2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Trypsinized/ Lifted a T125 flask of 1BR3 feeder fibroblasts(passage #: 12; 80% confluency) and added to 10mL of media</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Irradiated cells at 35 Gy of radiation (</span><span class="c9 c70 c46">134</span><span class="c9 c46">Cs source, 85 Gy/min)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Diluted cells to make 225mL of cell solution</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Seeded a layer of feeder cells on 220x60mm plates by pipetting 3mL of media and 1mL of seeder cells</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Placed in 37</span><img src="images/image00.png"><span class="c9 c46">C, 5% CO2 overnight</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 19, 2016</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_11-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Found a patent on a product that is very similar to ours with the inventors Minnie McMillan and Lynn E. Foster </span><span class="c31 c79">(Patent: </span><span class="c31 c71 c54 c112"><a class="c56" href="https://www.google.com/url?q=http://www.google.ch/patents/US20150050250&sa=D&ust=1475978705146000&usg=AFQjCNFVOA9TqdqYBWxJiTrBYvjvYUhjRQ">http://www.google.ch/patents/US20150050250</a></span><span class="c31 c71 c79">)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c81"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2 </span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_12-0">
| |
| − | <li class="c62 c11"><span class="c22">Counted 1BR3 cells from our T25 flask stock</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Well A: 4.02x10</span><span class="c22 c70">5</span><span class="c22"> (100% live); Well B: 2.92x10</span><span class="c22 c70">5</span><span class="c22">(100% live)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-0">
| |
| − | <li class="c62 c11"><span class="c22">Dilution and seeding of live 1BR3 cells to feeder plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-1 start">
| |
| − | <li class="c19 c11"><span class="c22">To make 115 mL cell concentration of 700 cells/mL for our 4 Gy radiation plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24 c48"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/d/d0/T--UofC_Calgary--syedj1.jpg">
| |
| − | </p>
| |
| − | <p class="c25 c11 c24 c63"><span class="c52"></span>
| |
| − | </p>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/0/00/T--UofC_Calgary--syedj2.jpg">
| |
| − | </p>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/e/e3/T--UofC_Calgary--syedj3.jpg">
| |
| − | </p>
| |
| − | <p class="c25 c11 c24 c63"><span></span>
| |
| − | </p>
| |
| − | <a id="t.915abc475495c15c906d2b6d356e0b6ebb71b1e5"></a>
| |
| − | <a id="t.8"></a>
| |
| − | <table class="c85">
| |
| − | <tbody>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="2">
| |
| − | <p class="c25 c11 c27"><span class="c29">Radiation (Gy)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="2">
| |
| − | <p class="c25 c11 c27"><span class="c29">Seeding concentration (Cells/mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c86" colspan="3" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c29">Volume for Serial Dilution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c104">
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Vol from previous concentration (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Vol Media (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Total Volume (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">700</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29"> </span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29"> </span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">115</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">75</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">30</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">105</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">65</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">60</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">125</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0.5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">200</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">85</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">21</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">106</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0.25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">175</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">66</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">9</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">75</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">150</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">35</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">40</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Plates previously seeded with feeder layer (August 18) were plated 1mL of cells diluted to the specified concentrations in the table above according to intended radiation treatment </span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Plates treated with various types of peptides (big BBI, 9mer, p(Y) 9mer, KTI, DTT+DMSO, control) (4-5PM)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 20, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2 </span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_13-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Cells irradiated with 137Cs source (8.5Gy/min) and designated Gy (0.25/1.7s, 0.5/3.5s, 1/7s, 2/14.1s, 4/28s) at 8AM (total incubation with peptides before radiation: 17hr)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 22, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2 - Contamination</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_14-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Plates for both the Clonogenic assay and the H2AX assay were found to be contaminated when looked at under the microscope (40x magnification); both assays are not able to continue</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Contaminated plates were disposed of; kept a few plates for reference to test the source of contamination</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 23, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2 - Contamination</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_15-0 start">
| |
| − | <li class="c62 c11"><span class="c22">Informed Nick Jette regarding contamination, he suggested we stop working out of the refrigerator as our chassis team, which may be the root of our contamination</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_15-1 start">
| |
| − | <li class="c19 c11"><span class="c22">He will contact Dr. Goodarzi to see if we will be able to use some of his lab space so that we do not get any further contamination</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_15-0">
| |
| − | <li class="c62 c11"><span class="c22">Look for the root of the contamination by plating various reagents on 60mm plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_15-1 start">
| |
| − | <li class="c19 c11"><span class="c22">New unopened MEM (control plate)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Old media (5mL)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">DPBS (1mL) + MEM (4mL)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Trypsin (1mL) + MEM (4mL)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">MEM (5mL) + assortment of mBBI peptides</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">MEM pipetted by Nick (to test technique)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">MEM pipetted by Nilesh (to test technique)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">MEM pipetted by Sid (to test technique)</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">MEM left open in the incubator (to test bacterial growth in incubator</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_15-0">
| |
| − | <li class="c62 c11"><span class="c22">Plates were left in the incubator (37C, 5% CO2) overnight</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">August 24, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 1.2 - Contamination Results</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_16-1 start">
| |
| − | <li class="c19 c11"><span class="c22">No growth observed in plates containing new or old media, DPBS, media plated by all experimenters</span>
| |
| − | </li>
| |
| − | <li class="c19 c11"><span class="c22">Bacterial growth found in plates containing trypsin (viewed under 100x)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_16-0 start">
| |
| − | <li class="c62 c11"><span class="c22">More cells (1 x T75 flask (50% confluent as of today)) will be obtained (we will most likely when our trypsin comes in</span>
| |
| − | </li>
| |
| − | <li class="c62 c11"><span class="c22">Wendy (lab technician) donated 5 x T75 flasks as well as 60 x T25 flasks to us</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23">September 2, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c31 c54">1BR3 Clonogenic 2.0 </span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Trypsinized/ Lifted a T75 flask of 1BR3 feeder fibroblasts(passage #: 12; 80% confluency) and added to 10mL of media</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Irradiated cells at 35 Gy of radiation (</span><span class="c9 c70 c46">134</span><span class="c9 c46">Cs source, 85 Gy/min)</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Diluted cells to make 110mL of cell solution</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Seeded a layer of feeder cells on 108x60mm plates by pipetting 3mL of media and 1mL of seeder cells</span>
| |
| − | </li>
| |
| − | <li class="c5"><span class="c9 c46">Placed in 37</span><img src="images/image00.png"><span class="c9 c46">C, 5% CO2 overnight</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c22"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">September 3, 2016</span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 2.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_12-0">
| |
| − | <li class="c62 c11"><span class="c22">Counted 1BR3 cells from our T25 flask stock</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-1 start">
| |
| − | <li class="c19 c11"><span class="c22">Well A: 2.56x10</span><span class="c22 c70">5</span><span class="c22"> (93% live); Well B: 2.01x10</span><span class="c22 c70">5</span><span class="c22">(98% live)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-0">
| |
| − | <li class="c62 c11"><span class="c22">Dilution and seeding of live 1BR3 cells to feeder plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_12-1 start">
| |
| − | <li class="c19 c11"><span class="c22">To make 115 mL cell concentration of 700 cells/mL for our 4 Gy radiation plates</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/5/59/T--UofC_Calgary--syedj4.jpg">
| |
| − | </p>
| |
| − | <p class="c25 c11 c24 c63"><span class="c52"></span>
| |
| − | </p>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/f/f0/T--UofC_Calgary--syedj5.jpg">
| |
| − | </p>
| |
| − | <p class="c11 c27"><img src="https://static.igem.org/mediawiki/2016/8/8c/T--UofC_Calgary--syedj6.jpg">
| |
| − | </p>
| |
| − | <p class="c11 c24 c78"><span></span>
| |
| − | </p>
| |
| − | <a id="t.4ea4ebd9c396a9cc82baab581e5559b1bb2c116c"></a>
| |
| − | <a id="t.9"></a>
| |
| − | <table class="c85">
| |
| − | <tbody>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="2">
| |
| − | <p class="c25 c11 c27"><span class="c29">Radiation (Gy)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="2">
| |
| − | <p class="c25 c11 c27"><span class="c29">Seeding concentration (Cells/mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c86" colspan="3" rowspan="1">
| |
| − | <p class="c25 c11 c27"><span class="c29">Volume for Serial Dilution</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c104">
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Vol from previous concentration (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Vol Media (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29">Total Volume (mL)</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">700</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29"> </span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c13 c11"><span class="c29"> </span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">57</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">2</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">500</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">37</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">15</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">52</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">1</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">250</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">32</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">31</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">63</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0.5</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">200</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">43</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">10</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">53</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0.25</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">175</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">33</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">4</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">37</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | <tr class="c7">
| |
| − | <td class="c55" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">0</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c14" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">150</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c15" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">17</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c37" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">3</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | <td class="c57" colspan="1" rowspan="1">
| |
| − | <p class="c2"><span class="c29">20</span>
| |
| − | </p>
| |
| − | </td>
| |
| − | </tr>
| |
| − | </tbody>
| |
| − | </table>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Plates previously seeded with feeder layer (September 2) were plated 1mL of cells diluted to the specified concentrations in the table above according to intended radiation treatment (4-5 PM)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24"><span class="c23 c46"></span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c23 c46">September 5, 2016 </span>
| |
| − | </p>
| |
| − | <p class="c11"><span class="c4">1BR3 Clonogenic 2.0</span>
| |
| − | </p>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Treatment with various peptides (big BBI, 9mer, p(Y) 9mer, KTI, DTT+DMSO, no treatment control) </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Peptides were added to a final concentration of 20uM</span>
| |
| − | </li>
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">Done at 7 AM</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Irradiation with various Gy of radiation according to original plan and seeding</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-1 start">
| |
| − | <li class="c25 c19 c11"><span class="c9 c46">1 PM (for total 6 hr. incubation with peptide)</span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <ul class="c30 lst-kix_list_25-0">
| |
| − | <li class="c5"><span class="c9 c46">Placed in Placed in 37</span><img src="images/image00.png"><span class="c9 c46">C, 5% CO2 </span>
| |
| − | </li>
| |
| − | </ul>
| |
| − | <p class="c11 c24 c78"><span class="c22"></span>
| |
| − | </p>
| |
| − | </div>
| |
| − |
| |
| − | </div>
| |
| − |
| |
| − | <div class="c-content-box c-size-md c-bg-darkblue" style="padding-bottom: 0px">
| |
| − | <div class="container">
| |
| − | <div class="c-content-title-1">
| |
| − | <h3 class="c-center c-font-uppercase c-font-bold" style="color:#EBDEBE">Engagement</h3>
| |
| − | <div class="c-line-center c-theme-bg">
| |
| − | </div>
| |
| − | </div>
| |
| − | <div class="row">
| |
| − | <div class="col-sm-3" style="padding-left:40px">
| |
| − | <img class="box-img" src="https://static.igem.org/mediawiki/2016/3/3e/T--UofC_Calgary--letstalk.png"> </img>
| |
| − | </div>
| |
| − | <div class="col-sm-3" style="padding-left:28px; padding-right:28px">
| |
| − | <img class="box-img" src="https://static.igem.org/mediawiki/2016/8/8f/T--UofC_Calgary--telusspark.png"> </img>
| |
| − | </div>
| |
| − | <div class="col-sm-3" style="padding-right:40px">
| |
| − | <img class="box-img" src="https://static.igem.org/mediawiki/2016/6/61/T--UofC_Calgary--mindsin.png"> </img>
| |
| − | </div>
| |
| − | <div class="col-sm-3" style="padding-right:40px">
| |
| − | <img class="box-img" src="https://static.igem.org/mediawiki/2016/7/70/T--UofC_Calgary--Beakernight.png"> </img>
| |
| − | </div>
| |
| − | </div> <span id="third" />
| |
| − | <div class="human-practices-div-4" style="padding-top: 25px; padding-bottom: 25px; color: #EBDEBE;"> Click to learn more about each of our engagements.</div>
| |
| − | </div>
| |
| − | </div>
| |
| − |
| |
| − | <div class="c-content-box c-size-md" ; padding-bottom: 0px; ">
| |
| − | <div class="container ">
| |
| − | <div class="c-content-title-1 ">
| |
| − | <h3 class="c-center c-font-uppercase c-font-bold " style="color:#223237 " >Collaboration</h3>
| |
| − | <div class="c-line-center c-theme-bg ">
| |
| | </div> | | </div> |
| − | </div>
| |
| − |
| |
| − | <style type="text/css ">
| |
| − | @import url('https://themes.googleusercontent.com/fonts/css?kit=M88JnubLobM--kNYN1H7JImz4LFx-WH96_kRiD6IAG4');
| |
| − | .lst-kix_list_98-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_98-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_98-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-0>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-0
| |
| − | }
| |
| − | .lst-kix_list_60-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_118-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-8 0
| |
| − | }
| |
| − | .lst-kix_list_130-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_130-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_45-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-2
| |
| − | }
| |
| − | .lst-kix_list_98-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-7
| |
| − | }
| |
| − | .lst-kix_list_60-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_93-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_42-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_112-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_93-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_42-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_112-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_93-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_105-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_93-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_79-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_130-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_130-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_42-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_112-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_42-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_80-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_79-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_79-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_27-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_27-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_79-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_80-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_80-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_80-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_24-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_79-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_27-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-3 0
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_27-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_27-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_23-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_23-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_23-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_24-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_23-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_80-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_43-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_80-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_80-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_22-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_43-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_43-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_22-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_22-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_102-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_102-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-2.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-2 0
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_43-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_99-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_99-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_99-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-7>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-7
| |
| − | }
| |
| − | .lst-kix_list_78-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_78-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_99-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_62-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_78-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_78-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_80-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_120-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-7 0
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_78-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_6ppt4s25kk1y-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_41-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_61-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_40-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_62-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_40-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_61-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_96-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_96-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_62-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_62-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_96-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_62-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_71-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_71-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_81-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_71-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_127-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_127-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_127-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_97-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_127-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_71-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_127-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_71-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_127-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_81-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_127-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_96-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_127-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_71-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_71-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_71-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_71-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_97-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_127-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_18-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_18-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_18-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_61-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_61-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_97-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_18-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_40-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_61-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_97-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_77-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_136-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_77-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_136-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_136-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-4 0
| |
| − | }
| |
| − | .lst-kix_list_81-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_103-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_103-1 0
| |
| − | }
| |
| − | .lst-kix_list_21-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-0 0
| |
| − | }
| |
| − | .lst-kix_list_114-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_26-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_69-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-5 0
| |
| − | }
| |
| − | ul.lst-kix_list_101-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_36-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_101-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_63-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-5 0
| |
| − | }
| |
| − | ul.lst-kix_list_101-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-4, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_26-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_128-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_63-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_36-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_36-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_36-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_26-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_95-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_114-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_23-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_128-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_114-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_114-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_59-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_12-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_58-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_12-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_115-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_45-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-6 0
| |
| − | }
| |
| − | ol.lst-kix_list_12-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_23-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_45-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-5, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_23-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_129-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-7.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-7 0
| |
| − | }
| |
| − | .lst-kix_list_58-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_114-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_58-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_58-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_129-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_69-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_69-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_109-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_58-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_58-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_109-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_109-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_59-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_44-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_113-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_113-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_49-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_134-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_49-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_7-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_39-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_49-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_49-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_49-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_7-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_127-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-4, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_127-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-0, decimal) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_133-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_105-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_105-2
| |
| − | }
| |
| − | ol.lst-kix_list_133-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_46-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_111-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_118-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-3
| |
| − | }
| |
| − | .lst-kix_list_132-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_120-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_120-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_120-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_131-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_133-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_132-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_28-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_123-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-8, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_130-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_123-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_123-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_110-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_131-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_107-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-3
| |
| − | }
| |
| − | ul.lst-kix_list_14-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_14-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_131-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_27-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_110-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_132-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_89-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_132-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-7 0
| |
| − | }
| |
| − | ul.lst-kix_list_89-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_126-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_126-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_132-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_93-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_132-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_19-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_56-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_47-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_65-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_135-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_89-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_89-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_132-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_93-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_32-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_84-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_32-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-3
| |
| − | }
| |
| − | .lst-kix_list_84-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_32-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_32-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_32-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_117-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-1, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_37-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_107-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_117-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-7, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_37-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_110-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-7
| |
| − | }
| |
| − | .lst-kix_list_37-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_110-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_108-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_107-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-2>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-2
| |
| − | }
| |
| − | ol.lst-kix_list_133-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-2 0
| |
| − | }
| |
| − | ol.lst-kix_list_107-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_66-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_107-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-4, lower-latin) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_107-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_136-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_107-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-2 0
| |
| − | }
| |
| − | ol.lst-kix_list_107-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_116-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_69-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-5
| |
| − | }
| |
| − | .lst-kix_list_66-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_116-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_110-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_110-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_92-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_54-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_54-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_54-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_135-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_92-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_136-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_54-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_108-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_136-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_118-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_69-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-1
| |
| − | }
| |
| − | .lst-kix_list_64-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_45-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-5>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-5
| |
| − | }
| |
| − | ul.lst-kix_list_3-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_73-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_85-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_3-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_64-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_3-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_85-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_94-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_3-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-5, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_3-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_73-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_3-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_3-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_57-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_36-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_109-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_109-2
| |
| − | }
| |
| − | .lst-kix_list_94-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_107-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-5
| |
| − | }
| |
| − | .lst-kix_list_83-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_36-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_57-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_73-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_67-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_95-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_67-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_74-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_74-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_95-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_83-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_20-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_20-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_75-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_104-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_104-1
| |
| − | }
| |
| − | ul.lst-kix_list_67-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_67-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_75-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_54-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_10-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-0 0
| |
| − | }
| |
| − | ul.lst-kix_list_10-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_55-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_76-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_10-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_10-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_82-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_82-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_54-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_75-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_76-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_55-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-7, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_85-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_105-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_85-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_85-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_85-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_85-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_100-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_85-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_35-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_77-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_77-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_85-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_85-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_85-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_3-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_8-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_119-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-1, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_30-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_72-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_69-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-8
| |
| − | }
| |
| − | ol.lst-kix_list_118-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-5 0
| |
| − | }
| |
| − | .lst-kix_list_133-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_26-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_21-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_68-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_123-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_63-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_63-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_90-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_106-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_106-1
| |
| − | }
| |
| − | .lst-kix_list_58-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_87-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_128-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_17-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_45-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_91-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_103-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_103-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_129-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_67-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_16-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_117-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-4
| |
| − | }
| |
| − | ul.lst-kix_list_50-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_86-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_114-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_50-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_50-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_71-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_50-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_59-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_109-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_41-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_41-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_69-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-0, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_41-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_27-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_41-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_41-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-6
| |
| − | }
| |
| − | .lst-kix_list_18-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_13-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-0
| |
| − | }
| |
| − | .lst-kix_list_122-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_127-1>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_106-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_39-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_76-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-0
| |
| − | }
| |
| − | ul.lst-kix_list_76-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_76-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_31-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_76-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_113-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_67-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_134-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_106-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_63-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_63-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_63-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_63-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_105-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_105-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_63-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_132-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_63-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-2
| |
| − | }
| |
| − | ul.lst-kix_list_63-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_63-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_63-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_124-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_103-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_11-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_118-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-6 0
| |
| − | }
| |
| − | .lst-kix_list_32-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_1-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_98-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_98-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_98-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_98-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_98-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_98-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_104-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_98-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_98-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_98-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_110-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_69-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_131-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_48-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_102-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_102-2
| |
| − | }
| |
| − | .lst-kix_list_104-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_28-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_51-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_14-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_121-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_120-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-0 0
| |
| − | }
| |
| − | .lst-kix_list_51-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_14-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_14-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_45-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-4 0
| |
| − | }
| |
| − | .lst-kix_list_121-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_118-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-6
| |
| − | }
| |
| − | .lst-kix_list_89-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_89-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_51-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_51-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_133-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-8 0
| |
| − | }
| |
| − | ul.lst-kix_list_70-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_128-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_89-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_128-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_70-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_70-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_128-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_102-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_102-1, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_70-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_89-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_128-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_102-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_17-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_17-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_17-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_17-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_32-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_89-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_117-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-4 0
| |
| − | }
| |
| − | .lst-kix_list_70-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_5-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_5-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_70-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_8-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_88-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_5-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_104-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_104-1 0
| |
| − | }
| |
| − | .lst-kix_list_5-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_8-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_8-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_70-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_50-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_50-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_92-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_6-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_6-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-6, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_92-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_92-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_106-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_50-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_121-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_50-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_39-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_39-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_6-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_83-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_69-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-1, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_83-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_115-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_115-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_115-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_83-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_101-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_34-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_12-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-6
| |
| − | }
| |
| − | ol.lst-kix_list_118-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-1 0
| |
| − | }
| |
| − | .lst-kix_list_101-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_122-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_52-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_52-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_15-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_122-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_4-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_15-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_15-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_69-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-0
| |
| − | }
| |
| − | .lst-kix_list_88-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-4.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-4 0
| |
| − | }
| |
| − | .lst-kix_list_103-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_102-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_53-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-3
| |
| − | }
| |
| − | .lst-kix_list_103-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_133-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-3
| |
| − | }
| |
| − | .lst-kix_list_12-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_32-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_33-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-4
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_117-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-8
| |
| − | }
| |
| − | .lst-kix_list_34-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_104-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_120-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-5 0
| |
| − | }
| |
| − | .lst-kix_list_69-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-7, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_33-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-8
| |
| − | }
| |
| − | .lst-kix_list_33-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_104-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-2
| |
| − | }
| |
| − | .lst-kix_list_34-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-2
| |
| − | }
| |
| − | .lst-kix_list_72-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_100-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_105-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_105-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_35-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_35-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_35-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_105-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_105-1, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_105-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_30-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_3-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_72-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_86-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_108-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_108-2 0
| |
| − | }
| |
| − | .lst-kix_list_3-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_72-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_124-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-5
| |
| − | }
| |
| − | ul.lst-kix_list_124-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_124-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_123-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_13-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_13-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_53-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_53-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_123-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_13-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_13-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_69-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-6
| |
| − | }
| |
| − | ul.lst-kix_list_13-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_123-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_123-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_68-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_11-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_90-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_8-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_4-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_90-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_87-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_91-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_16-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_4-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_67-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_4-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_91-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_91-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_67-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_91-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_4-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_835ax5k7z1l9-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_4-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_86-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_35-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_86-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_35-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_71-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_35-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_86-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_102-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_102-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_17-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_87-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_1qgee6j7obt0-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_71-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_133-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-2
| |
| − | }
| |
| − | ul.lst-kix_list_35-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_100-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_35-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_35-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_71-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_72-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_7-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_100-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_111-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_85-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_111-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-4 0
| |
| − | }
| |
| − | ul.lst-kix_list_111-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_26-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_85-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_118-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_7-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_48-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_31-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_18-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_101-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_26-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_26-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_111-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_48-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_15-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_52-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_122-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_120-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-1 0
| |
| − | }
| |
| − | .lst-kix_list_10-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_10-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_73-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_120-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_15-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-8.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-8 0
| |
| − | }
| |
| − | .lst-kix_list_67-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-8
| |
| − | }
| |
| − | ul.lst-kix_list_48-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_48-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_48-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_48-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_53-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_124-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_11-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_103-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_29-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_48-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_48-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_48-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_54-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_48-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-3 0
| |
| − | }
| |
| − | ul.lst-kix_list_48-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_1-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_104-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_104-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_119-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_34-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_45-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-8 0
| |
| − | }
| |
| − | .lst-kix_list_33-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-3>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-3
| |
| − | }
| |
| − | .lst-kix_list_2-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_1-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_104-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_49-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_34-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_126-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_66-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_66-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_66-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_66-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_93-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_66-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_66-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_66-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_66-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_93-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_126-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_66-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_135-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_56-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-0, upper-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_118-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-8
| |
| − | }
| |
| − | .lst-kix_list_84-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_47-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_74-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_84-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_61pipssxjd5z-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_107-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_84-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_19-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_104-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_104-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_88-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-1
| |
| − | }
| |
| − | ul.lst-kix_list_88-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_88-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_116-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_107-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_66-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_116-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_37-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_103-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_103-1
| |
| − | }
| |
| − | .lst-kix_list_37-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_88-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_46-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_116-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_108-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_135-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_31-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_31-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_92-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_31-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_135-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_31-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_108-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_108-2
| |
| − | }
| |
| − | ol.lst-kix_list_119-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_18-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_119-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_119-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_119-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_31-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-5 0
| |
| − | }
| |
| − | ol.lst-kix_list_119-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_133-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-7 0
| |
| − | }
| |
| − | .lst-kix_list_45-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-4
| |
| − | }
| |
| − | .lst-kix_list_66-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_136-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_93-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_133-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-5
| |
| − | }
| |
| − | ol.lst-kix_list_45-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-5 0
| |
| − | }
| |
| − | .lst-kix_list_92-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_136-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_133-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-8
| |
| − | }
| |
| − | ul.lst-kix_list_22-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_22-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_64-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_22-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_22-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_22-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_64-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_85-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_118-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-0
| |
| − | }
| |
| − | .lst-kix_list_127-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_109-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_39-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_55-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_10-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_18-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_22-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_106-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_106-1, lower-latin) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_45-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-3 0
| |
| − | }
| |
| − | .lst-kix_list_106-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_36-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_57-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_73-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_57-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-5.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-5 0
| |
| − | }
| |
| − | .lst-kix_list_94-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-3, decimal) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_45-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-0 0
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-4 0
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_57-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_46-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_57-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_44-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_44-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_82-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_75-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_117-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-8 0
| |
| − | }
| |
| − | ol.lst-kix_list_120-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-6 0
| |
| − | }
| |
| − | ul.lst-kix_list_44-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_74-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_83-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_1-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_11-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_124-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_79-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_76-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_79-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_55-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_79-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_79-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_79-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-5, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_79-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_109-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_109-1 0
| |
| − | }
| |
| − | .lst-kix_list_54-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-3.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-3 0
| |
| − | }
| |
| − | .lst-kix_list_125-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_48-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_79-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_79-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_79-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_62-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_30-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_35-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_62-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_62-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_105-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-0
| |
| − | }
| |
| − | .lst-kix_list_68-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_97-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_8-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_97-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_3-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_97-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_97-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_68-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_21-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_90-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_117-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-7 0
| |
| − | }
| |
| − | ul.lst-kix_list_84-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_58-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_84-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_84-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_84-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_107-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-7
| |
| − | }
| |
| − | ul.lst-kix_list_84-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-1.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-1 0
| |
| − | }
| |
| − | .lst-kix_list_115-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_84-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_84-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_84-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_84-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_129-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_45-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-4, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_87-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_45-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-7, decimal) ". "
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-0.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-0 0
| |
| − | }
| |
| − | .lst-kix_list_71-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_44-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_120-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-8 0
| |
| − | }
| |
| − | .lst-kix_list_129-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_17-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_59-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_59-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_17-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_45-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-7
| |
| − | }
| |
| − | .lst-kix_list_27-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_69-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-4, decimal) ". "
| |
| − | }
| |
| − | ol.lst-kix_list_106-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_106-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_122-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_52-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_94-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_64-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_117-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-3 0
| |
| − | }
| |
| − | .lst-kix_list_107-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-4
| |
| − | }
| |
| − | .lst-kix_list_78-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_31-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_53-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_53-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-0 0
| |
| − | }
| |
| − | ul.lst-kix_list_53-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_106-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_101-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_53-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_88-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_4-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_80-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_36-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_69-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-3
| |
| − | }
| |
| − | .lst-kix_list_9-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_40-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_40-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_103-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_40-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_117-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-1 0
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_40-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_74-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_40-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_40-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_83-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_41-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_111-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_75-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_112-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_75-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-8, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_75-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_131-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_75-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_75-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-5
| |
| − | }
| |
| − | ol.lst-kix_list_117-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-2 0
| |
| − | }
| |
| − | .lst-kix_list_97-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_61-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_12-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_55-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_125-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_126-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_13-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_54-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_98-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_98-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_98-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_98-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_9-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_42-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_130-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_9-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_9-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_9-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_130-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_130-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_98-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_9-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_60-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_42-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_112-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_42-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_112-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_112-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_130-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_119-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-0 0
| |
| − | }
| |
| − | .lst-kix_list_42-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_42-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_112-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_24-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_79-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_79-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_24-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_79-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_24-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_lvjn8glkfwf0-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_79-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_129-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_23-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_23-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_16-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_23-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_129-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_129-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_24-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_16-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_16-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_107-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-8 0
| |
| − | }
| |
| − | .lst-kix_list_23-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_60-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_113-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_113-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_106-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_106-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_60-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_117-6 0
| |
| − | }
| |
| − | ul.lst-kix_list_60-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_60-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_113-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_95-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_103-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_95-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-3 0
| |
| − | }
| |
| − | ol.lst-kix_list_69-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-4 0
| |
| − | }
| |
| − | .lst-kix_list_25-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_113-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_113-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_fahi2s4j7zmm-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_82-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_132-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_116-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_45-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_116-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_116-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_116-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_116-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_116-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_116-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_132-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_132-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_116-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_116-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_82-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_111-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_132-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_111-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_131-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_29-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_110-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_29-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_109-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_109-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_29-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_112-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_29-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_29-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_110-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_131-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_110-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_131-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_110-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_119-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-5 0
| |
| − | }
| |
| − | .lst-kix_list_110-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_131-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_47-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-4
| |
| − | }
| |
| − | ul.lst-kix_list_47-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_g5lskmm1i0dj-6.start {
| |
| − | counter-reset: lst-ctn-kix_g5lskmm1i0dj-6 0
| |
| − | }
| |
| − | ul.lst-kix_list_47-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-6
| |
| − | }
| |
| − | .lst-kix_list_77-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_81-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_5-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_47-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_47-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_120-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_120-3 0
| |
| − | }
| |
| − | ul.lst-kix_list_47-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_5-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_114-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_5-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_77-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_5-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-0
| |
| − | }
| |
| − | ul.lst-kix_list_5-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_26-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_133-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_21-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_45-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_45-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_45-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_45-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_45-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-3
| |
| − | }
| |
| − | ol.lst-kix_list_45-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-6
| |
| − | }
| |
| − | ol.lst-kix_list_45-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_128-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_45-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_63-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_95-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_45-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_45-7 0
| |
| − | }
| |
| − | .lst-kix_list_133-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-7, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_21-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_63-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_58-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_128-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_115-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-6 0
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-8>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-8
| |
| − | }
| |
| − | .lst-kix_list_45-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_58-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_25-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_102-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_102-1
| |
| − | }
| |
| − | .lst-kix_list_129-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_45-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-6, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_125-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_125-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-1>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-1
| |
| − | }
| |
| − | .lst-kix_list_119-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-8
| |
| − | }
| |
| − | ul.lst-kix_list_125-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_125-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_125-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_125-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_109-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_109-1, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_44-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_125-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_125-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_125-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_114-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_129-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_133-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_133-1 0
| |
| − | }
| |
| − | .lst-kix_list_59-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_109-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_59-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_103-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_103-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_134-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_64-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_134-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_80-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_134-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_22-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_134-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_134-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_134-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_43-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_43-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_134-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_134-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_64-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-1
| |
| − | }
| |
| − | .lst-kix_list_133-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-7
| |
| − | }
| |
| − | .lst-kix_list_45-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-8
| |
| − | }
| |
| − | .lst-kix_list_22-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_134-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_ee0fx9z4yp3a-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_76-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_1qgee6j7obt0-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_97-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_80-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_94-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_99-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_91-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_78-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_78-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_38-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_57-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_57-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_38-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_91-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_91-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_99-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_99-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_91-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_91-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_91-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_83-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_91-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_91-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_94-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_91-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_108-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_108-1 0
| |
| − | }
| |
| − | .lst-kix_list_62-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_38-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_80-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_38-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_38-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_94-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_112-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_95-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_25-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_108-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_108-1
| |
| − | }
| |
| − | ul.lst-kix_list_25-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_82-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_25-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_96-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_25-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_112-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_61-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_112-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_95-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_83-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_40-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_69-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-4
| |
| − | }
| |
| − | ol.lst-kix_list_102-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_102-1 0
| |
| − | }
| |
| − | .lst-kix_list_41-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_20-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_75-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_96-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_25-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_41-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_20-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_25-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_25-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-3
| |
| − | }
| |
| − | .lst-kix_list_83-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_62-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_81-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_97-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_117-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-5
| |
| − | }
| |
| − | .lst-kix_list_60-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_81-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_82-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_61-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_82-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_75-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_96-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_76-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_97-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_40-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_93-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_43-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_93-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_126-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_43-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_1-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_43-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_19-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_43-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_135-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_47-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_1-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_126-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_1-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_135-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_1-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_1-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-7
| |
| − | }
| |
| − | ul.lst-kix_list_78-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_117-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_84-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_74-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_84-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_78-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_78-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_117-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-4, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_19-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_74-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_47-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_118-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-2 0
| |
| − | }
| |
| − | .lst-kix_list_107-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-1, lower-latin) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_65-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_65-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-7, lower-latin) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_65-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_136-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_65-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_116-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_37-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_46-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_116-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_37-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_66-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_121-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_121-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_121-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_65-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_121-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_121-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_92-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_18-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_121-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_121-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_18-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_65-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_104-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_104-2
| |
| − | }
| |
| − | .lst-kix_list_66-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_92-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_136-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_92-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_121-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_121-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_130-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_130-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_27-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_130-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_130-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_134-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_27-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_130-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_18-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_69-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-2
| |
| − | }
| |
| − | ul.lst-kix_list_130-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_130-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_130-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_130-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_34-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_127-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_34-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_34-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-5, lower-roman) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_34-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_106-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_127-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_106-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_67-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-5
| |
| − | }
| |
| − | ul.lst-kix_list_34-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_34-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_21-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_21-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_124-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_109-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_21-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_124-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_109-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_124-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_29-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_49-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_9-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-7, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_133-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-1, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_56-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_56-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_56-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_56-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_56-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_56-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_56-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_125-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_49-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_1-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_28-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-6>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-6
| |
| − | }
| |
| − | .lst-kix_list_2-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_107-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-5 0
| |
| − | }
| |
| − | .lst-kix_list_126-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_56-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_2-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_56-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_35-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_100-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_77-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_72-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_30-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_114-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_26-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_3-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_81-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_105-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_74-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_8-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_74-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_74-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_95-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_90-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_128-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_123-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_63-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_53-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_68-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_21-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_61-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_128-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_45-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_91-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_61-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_25-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_61-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_61-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_129-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_59-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_58-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_86-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_96-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_114-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_96-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_96-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_96-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_59-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_96-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_96-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_39-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_96-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_96-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_96-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_87-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_100-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_45-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_45-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_17-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_71-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_87-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_87-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_85-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_87-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_80-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_87-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_87-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_87-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_87-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-0, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_87-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_43-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_43-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_22-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_87-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-4 0
| |
| − | }
| |
| − | .lst-kix_list_64-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_109-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_118-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_55-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_101-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_lvjn8glkfwf0-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_105-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_105-1 0
| |
| − | }
| |
| − | ul.lst-kix_list_30-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_30-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_73-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_30-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_94-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_78-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_118-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_99-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_118-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_52-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_118-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_118-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_30-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_57-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_57-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_30-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_116-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_118-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_20-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_41-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_107-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-2
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_118-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-2
| |
| − | }
| |
| − | .lst-kix_list_41-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_62-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_102-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_82-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_105-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_75-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_54-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_105-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_33-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_83-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_61pipssxjd5z-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_53-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_52-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_52-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_52-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_52-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-4, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_52-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_76-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_52-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_55-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_108-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_52-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_52-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_96-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_52-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_108-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_118-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_118-7 0
| |
| − | }
| |
| − | .lst-kix_list_61-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_40-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_97-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_121-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_51-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_81-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_81-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_69-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_69-7
| |
| − | }
| |
| − | ul.lst-kix_list_28-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_28-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_81-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_81-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_81-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_81-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_121-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_81-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_51-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_51-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_81-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_121-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_81-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_89-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_51-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_28-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_14-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_tn8cl5j8lycz-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_89-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_102-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_12-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-0 0
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_32-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_102-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_32-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_102-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_102-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_102-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_89-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_89-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_102-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_5-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_70-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_5-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_120-1
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_5-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_70-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_5-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_70-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_88-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_fahi2s4j7zmm-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_70-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_70-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_70-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_88-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_88-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_107-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-1 0
| |
| − | }
| |
| − | ol.lst-kix_list_12-5.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-5 0
| |
| − | }
| |
| − | .lst-kix_list_120-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-4, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_120-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-5, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_50-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_50-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_50-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-7, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_6-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_50-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_120-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_121-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_6-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_51-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_50-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_6-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_121-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_121-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-1
| |
| − | }
| |
| − | .lst-kix_list_69-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_69-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-5, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_122-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_52-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_122-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_13-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_7-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_101-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_72-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_126-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_72-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_72-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_31-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_31-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_45-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-6
| |
| − | }
| |
| − | ul.lst-kix_list_72-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_126-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_52-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_126-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_120-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_120-1, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_126-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_122-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_126-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_126-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_72-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_126-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_31-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_126-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_126-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_72-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_101-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_72-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_72-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_107-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-6 0
| |
| − | }
| |
| − | ul.lst-kix_list_72-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_88-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_19-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-7 0
| |
| − | }
| |
| − | ul.lst-kix_list_19-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_19-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_103-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_103-2
| |
| − | }
| |
| − | .lst-kix_list_88-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_19-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_19-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_123-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_32-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_103-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_103-1, lower-latin) ". "
| |
| − | }
| |
| − | .lst-kix_list_33-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_12-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-1, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_45-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-5
| |
| − | }
| |
| − | .lst-kix_list_33-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_53-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_109-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_109-1
| |
| − | }
| |
| − | .lst-kix_list_32-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_103-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_94-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_94-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_104-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_104-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_104-1, lower-latin) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_94-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_69-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_94-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_13-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_94-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_104-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_94-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_94-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_34-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_94-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_94-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-5, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_12-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-7, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_107-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-6
| |
| − | }
| |
| − | .lst-kix_list_106-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_106-2
| |
| − | }
| |
| − | .lst-kix_list_104-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_13-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_113-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_105-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_35-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_113-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_113-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_100-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_68-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_68-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_72-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_24-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_24-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_3-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_8-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_30-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_3-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_59-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_90-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_8-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_68-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_3-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_119-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-3 0
| |
| − | }
| |
| − | .lst-kix_list_90-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_8-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_90-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_35-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_59-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_59-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_16-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_16-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_46-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_87-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_46-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_91-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_46-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_17-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_4-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_87-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_16-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_46-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_46-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_87-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_71-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_86-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_71-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_17-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_17-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_69-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-6 0
| |
| − | }
| |
| − | ol.lst-kix_list_119-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-2 0
| |
| − | }
| |
| − | .lst-kix_list_69-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-2, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_2-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_85-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_69-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_69-6, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_10-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_117-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-0
| |
| − | }
| |
| − | ul.lst-kix_list_90-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_122-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_18-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_106-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_106-2, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_7-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_73-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_36-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_122-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_122-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_122-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_122-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_31-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_122-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_122-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_122-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_106-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_101-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_122-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_36-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_69-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-7 0
| |
| − | }
| |
| − | ul.lst-kix_list_15-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_15-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_52-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_15-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_4-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_15-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_102-2.start {
| |
| − | counter-reset: lst-ctn-kix_list_102-2 0
| |
| − | }
| |
| − | ul.lst-kix_list_15-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_15-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_15-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_88-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_107-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_107-0 0
| |
| − | }
| |
| − | ul.lst-kix_list_122-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_135-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_135-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_135-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_135-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_135-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_74-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_135-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_29-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_135-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_103-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_103-2, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_135-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_tn8cl5j8lycz-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_32-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_135-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-4, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_6-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_124-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_6-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_33-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_1-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_11-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_6-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_6-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-6>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-6, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_100-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_100-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_13-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_100-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_13-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_90-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_90-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_55-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_54-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_37-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_37-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_37-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_100-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_12-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_55-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_20-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-1
| |
| − | }
| |
| − | ul.lst-kix_list_20-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_126-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_20-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-6 0
| |
| − | }
| |
| − | .lst-kix_list_93-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_20-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_56-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_69-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-8 0
| |
| − | }
| |
| − | .lst-kix_list_19-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_20-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_108-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_20-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_108-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_135-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_47-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_93-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol.lst-kix_list_119-6.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-6 0
| |
| − | }
| |
| − | ul.lst-kix_list_55-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_84-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_55-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_55-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_117-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-2, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_55-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_55-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_45-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_45-0
| |
| − | }
| |
| − | ul.lst-kix_list_55-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_55-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_55-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-8>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-8
| |
| − | }
| |
| − | .lst-kix_list_47-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_117-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-8, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_19-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_56-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_84-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_19-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_55-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_47-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_74-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_117-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_117-5, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_42-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_37-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_66-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_42-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-8>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-8, lower-roman) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_42-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_136-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_42-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_42-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_107-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_107-5, lower-roman) ". "
| |
| − | }
| |
| − | .lst-kix_list_117-3>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-3
| |
| − | }
| |
| − | ol.lst-kix_list_119-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-1 0
| |
| − | }
| |
| − | .lst-kix_list_116-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_118-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-4
| |
| − | }
| |
| − | .lst-kix_list_37-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_66-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_108-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_108-1, lower-latin) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_77-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-1
| |
| − | }
| |
| − | .lst-kix_list_119-5>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-5
| |
| − | }
| |
| − | .lst-kix_list_65-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_77-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_92-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_77-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_77-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_77-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_77-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_77-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_77-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_108-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_135-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_136-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_66-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_38-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_92-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_77-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_38-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_85-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_68-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_68-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_48-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_68-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_2-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_68-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_68-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_68-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-1
| |
| − | }
| |
| − | .lst-kix_list_48-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_64-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_118-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-1, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_76-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_18-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_39-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_118-7>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-7, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_68-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_127-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_68-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_68-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_94-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_127-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_10-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_11-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_57-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_11-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_36-8>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_11-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_57-7>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ul.lst-kix_list_11-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_73-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_11-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_11-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-1>li:before {
| |
| − | content: " " counter(lst-ctn-kix_g5lskmm1i0dj-1, lower-latin) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_11-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_134-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_69-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-1 0
| |
| − | }
| |
| − | .lst-kix_list_67-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_46-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_131-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-4 0
| |
| − | }
| |
| − | ol.lst-kix_list_69-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-3 0
| |
| − | }
| |
| − | .lst-kix_list_20-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_29-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_131-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_9-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_83-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_133-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_133-4
| |
| − | }
| |
| − | .lst-kix_list_20-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_2-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_12-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-1 0
| |
| − | }
| |
| − | .lst-kix_list_11-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_124-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_54-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_2-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_131-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_2-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_33-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_125-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_33-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_33-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_28-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_33-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_75-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_119-3>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-3, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_107-0>li {
| |
| − | counter-increment: lst-ctn-kix_list_107-0
| |
| − | }
| |
| − | .lst-kix_list_82-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_27-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_33-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_49-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_76-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_35-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_30-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_100-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_77-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_72-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_72-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_105-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_3-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_114-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ol.lst-kix_list_104-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_104-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_119-0>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_119-0, decimal) ". "
| |
| − | }
| |
| − | .lst-kix_list_114-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_81-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_12-3.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-3 0
| |
| − | }
| |
| − | .lst-kix_list_77-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_118-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_118-7
| |
| − | }
| |
| − | .lst-kix_list_133-2>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-2, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_51-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_51-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_51-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_21-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_51-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_63-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_106-1.start {
| |
| − | counter-reset: lst-ctn-kix_list_106-1 0
| |
| − | }
| |
| − | ul.lst-kix_list_51-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_51-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_51-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_133-5>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_133-5, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_51-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_51-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_11-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_58-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_128-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_117-6>li {
| |
| − | counter-increment: lst-ctn-kix_list_117-6
| |
| − | }
| |
| − | .lst-kix_list_53-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_123-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_128-4>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_95-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_6ppt4s25kk1y-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_68-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_123-5>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_63-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_12-4.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-4 0
| |
| − | }
| |
| − | .lst-kix_list_90-7>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_91-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_129-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_25-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_91-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_16-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_67-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_58-3>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_69-0.start {
| |
| − | counter-reset: lst-ctn-kix_list_69-0 0
| |
| − | }
| |
| − | ul.lst-kix_list_73-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_73-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_119-2>li {
| |
| − | counter-increment: lst-ctn-kix_list_119-2
| |
| − | }
| |
| − | ul.lst-kix_list_73-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_86-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_73-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-4>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-4
| |
| − | }
| |
| − | .lst-kix_list_109-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_73-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_44-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_86-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_115-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ul.lst-kix_list_73-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_73-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_73-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_119-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_119-8 0
| |
| − | }
| |
| − | ul.lst-kix_list_73-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_12-7>li {
| |
| − | counter-increment: lst-ctn-kix_list_12-7
| |
| − | }
| |
| − | .lst-kix_list_39-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_87-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_100-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_30-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_71-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_109-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_113-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_64-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_43-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_64-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_64-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_64-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_64-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_118-4>li:before {
| |
| − | content: " " counter(lst-ctn-kix_list_118-4, decimal) ". "
| |
| − | }
| |
| − | ul.lst-kix_list_64-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_7-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | .lst-kix_list_48-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_64-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_64-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_64-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_101-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_73-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | .lst-kix_list_85-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_g5lskmm1i0dj-4>li {
| |
| − | counter-increment: lst-ctn-kix_g5lskmm1i0dj-4
| |
| − | }
| |
| − | ul.lst-kix_list_99-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_99-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_52-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_99-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_99-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_127-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_67-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_835ax5k7z1l9-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_ee0fx9z4yp3a-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_15-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ul.lst-kix_list_99-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_10-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_57-4>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_12-7.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-7 0
| |
| − | }
| |
| − | ul.lst-kix_list_86-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_86-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_86-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_86-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_105-1>li {
| |
| − | counter-increment: lst-ctn-kix_list_105-1
| |
| − | }
| |
| − | ul.lst-kix_list_86-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_86-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_86-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_95-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_124-1>li:before {
| |
| − | content: "\0025cb "
| |
| − | }
| |
| − | ul.lst-kix_list_86-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_53-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ul.lst-kix_list_86-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ul.lst-kix_list_109-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_103-8>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_12-8.start {
| |
| − | counter-reset: lst-ctn-kix_list_12-8 0
| |
| − | }
| |
| − | .lst-kix_list_132-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_62-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_20-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_54-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_29-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_96-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | .lst-kix_list_104-4>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_117-5 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_110-1>li:before {
| |
| − | content: "o "
| |
| − | }
| |
| − | ol.lst-kix_list_117-6 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-7 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-8 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_81-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_28-6>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_117-1 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_1-6>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | ol.lst-kix_list_117-2 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-3 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | ol.lst-kix_list_117-4 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_82-2>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | ol.lst-kix_list_117-0 {
| |
| − | list-style-type: none
| |
| − | }
| |
| − | .lst-kix_list_76-5>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_33-7>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_40-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_105-0>li:before {
| |
| − | content: "\0025cf "
| |
| − | }
| |
| − | .lst-kix_list_34-3>li:before {
| |
| − | content: "\0025aa "
| |
| − | }
| |
| − | .lst-kix_list_2-2>li:before {
| |
| − | content: "\0025a0 "
| |
| − | }
| |
| − | ol {
| |
| − | margin: 0;
| |
| − | padding: 0
| |
| − | }
| |
| − | table td,
| |
| − | table th {
| |
| − | padding: 0
| |
| − | }
| |
| − | .c83 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 223.8pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c58 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 168.2pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c69 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 162.8pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c38 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 240.8pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c72 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 226.3pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c91 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 396.7pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c66 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 243.3pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c71 {
| |
| − | border-right-style: solid;
| |
| − | padding: 5.2pt 5.2pt 5.2pt 5.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 92.7pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c50 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 120.5pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c60 {
| |
| − | border-right-style: solid;
| |
| − | padding: 5.2pt 5.2pt 5.2pt 5.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 106.5pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c103 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 276.2pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c62 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 70.5pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c49 {
| |
| − | border-right-style: solid;
| |
| − | padding: 5.2pt 5.2pt 5.2pt 5.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 141.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c86 {
| |
| − | border-right-style: solid;
| |
| − | padding: 5.2pt 5.2pt 5.2pt 5.2pt;
| |
| − | border-bottom-color: #000000;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #000000;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #000000;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 105.8pt;
| |
| − | border-top-color: #000000;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c52 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 113.4pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c23 {
| |
| − | border-right-style: solid;
| |
| − | padding: 3.8pt 3.8pt 3.8pt 3.8pt;
| |
| − | border-bottom-color: #a3a3a3;
| |
| − | border-top-width: 1pt;
| |
| − | border-right-width: 1pt;
| |
| − | border-left-color: #a3a3a3;
| |
| − | vertical-align: top;
| |
| − | border-right-color: #a3a3a3;
| |
| − | border-left-width: 1pt;
| |
| − | border-top-style: solid;
| |
| − | border-left-style: solid;
| |
| − | border-bottom-width: 1pt;
| |
| − | width: 58.1pt;
| |
| − | border-top-color: #a3a3a3;
| |
| − | border-bottom-style: solid
| |
| − | }
| |
| − | .c5 {
| |
| − | margin-left: 108pt;
| |
| − | padding-top: 0pt;
| |
| − | padding-left: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c0 {
| |
| − | margin-left: 72pt;
| |
| − | padding-top: 0pt;
| |
| − | padding-left: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c9 {
| |
| − | color: #000000;
| |
| − | font-weight: 400;
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-size: 10pt;
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c6 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c20 {
| |
| − | margin-left: 72pt;
| |
| − | padding-left: 0pt;
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.15;
| |
| − | text-align: left
| |
| − | }
| |
| − | .c12 {
| |
| − | padding-bottom: 0pt;
| |
| − | line-height: 1.0;
| |
| − | orphans: 2;
| |
| − | widows: 2
| |
| − | }
| |
| − | .c25 {
| |
| − | padding-top: 0pt;
| |
| − | padding-bottom: 10pt;
| |
| − | line-height: 1.1500000000000001;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c104 {
| |
| − | margin-left: -3.8pt;
| |
| − | border-spacing: 0;
| |
| − | border-collapse: collapse;
| |
| − | margin-right: auto
| |
| − | }
| |
| − | .c87 {
| |
| − | margin-left: -5.2pt;
| |
| − | border-spacing: 0;
| |
| − | border-collapse: collapse;
| |
| − | margin-right: auto
| |
| − | }
| |
| − | .c1 {
| |
| − | font-size: 11pt;
| |
| − | font-family: "Asap ";
| |
| − | color: #000000;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c27 {
| |
| − | padding-top: 14pt;
| |
| − | padding-bottom: 14pt;
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c4 {
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2
| |
| − | }
| |
| − | .c41 {
| |
| − | font-size: 18pt;
| |
| − | color: #2e75b5;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c35 {
| |
| − | text-decoration: none;
| |
| − | vertical-align: baseline;
| |
| − | font-style: normal
| |
| − | }
| |
| − | .c57 {
| |
| − | margin-left: 0pt;
| |
| − | list-style-position: inside;
| |
| − | text-indent: 45pt
| |
| − | }
| |
| − | .c90 {
| |
| − | margin-left: 72pt;
| |
| − | text-indent: -18pt
| |
| − | }
| |
| − | .c44 {
| |
| − | padding-top: 0pt;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c33 {
| |
| − | padding-bottom: 6pt;
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c2 {
| |
| − | padding: 0;
| |
| − | margin: 0
| |
| − | }
| |
| − | .c61 {
| |
| − | padding-bottom: 14pt;
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c64 {
| |
| − | list-style-position: inside;
| |
| − | text-indent: 45pt
| |
| − | }
| |
| − | .c98 {
| |
| − | max-width: 468pt;
| |
| − | padding: 72pt 72pt 72pt 72pt
| |
| − | }
| |
| − | .c54 {
| |
| − | color: #1155cc;
| |
| − | text-decoration: underline
| |
| − | }
| |
| − | .c100 {
| |
| − | padding-top: 18pt;
| |
| − | padding-bottom: 6pt
| |
| − | }
| |
| − | .c28 {
| |
| − | color: inherit;
| |
| − | text-decoration: inherit
| |
| − | }
| |
| − | .c18 {
| |
| − | orphans: 2;
| |
| − | widows: 2
| |
| − | }
| |
| − | .c21 {
| |
| − | margin-left: 72pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c45 {
| |
| − | font-size: 7pt;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c8 {
| |
| − | margin-left: 36pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c94 {
| |
| − | padding-bottom: 10pt;
| |
| − | line-height: 1.1500000000000001
| |
| − | }
| |
| − | .c37 {
| |
| − | font-size: 16pt;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c11 {
| |
| − | margin-left: 54pt;
| |
| − | height: 10pt
| |
| − | }
| |
| − | .c26 {
| |
| − | font-size: 9pt;
| |
| − | font-style: italic
| |
| − | }
| |
| − | .c79 {
| |
| − | margin-left: 34.5pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c47 {
| |
| − | margin-left: 108pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c15 {
| |
| − | padding-top: 0pt;
| |
| − | text-align: left
| |
| − | }
| |
| − | .c10 {
| |
| − | font-size: 10pt;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c67 {
| |
| − | vertical-align: sub;
| |
| − | font-size: 6.5pt
| |
| − | }
| |
| − | .c81 {
| |
| − | padding-bottom: 6pt;
| |
| − | line-height: 1.1500000000000001
| |
| − | }
| |
| − | .c30 {
| |
| − | color: #1d2129;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c74 {
| |
| − | padding-top: 5pt;
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c7 {
| |
| − | font-size: 12pt;
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c32 {
| |
| − | padding-top: 0pt;
| |
| − | text-align: center
| |
| − | }
| |
| − | .c76 {
| |
| − | padding-bottom: 19pt;
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c40 {
| |
| − | margin-left: 144pt;
| |
| − | padding-left: 0pt
| |
| − | }
| |
| − | .c101 {
| |
| − | margin-left: 108pt
| |
| − | }
| |
| − | .c77 {
| |
| − | margin-left: 54pt
| |
| − | }
| |
| − | .c46 {
| |
| − | font-style: italic
| |
| − | }
| |
| − | .c14 {
| |
| − | height: 10pt
| |
| − | }
| |
| − | .c63 {
| |
| − | color: #2e75b5
| |
| − | }
| |
| − | .c16 {
| |
| − | font-size: 11pt
| |
| − | }
| |
| − | .c42 {
| |
| − | height: 0pt
| |
| − | }
| |
| − | .c3 {
| |
| − | font-family: "Asap "
| |
| − | }
| |
| − | .c96 {
| |
| − | padding-bottom: 12pt
| |
| − | }
| |
| − | .c89 {
| |
| − | font-size: 6.5pt
| |
| − | }
| |
| − | .c13 {
| |
| − | color: #000000
| |
| − | }
| |
| − | .c51 {
| |
| − | font-weight: 400
| |
| − | }
| |
| − | .c73 {
| |
| − | color: #595959
| |
| − | }
| |
| − | .c97 {
| |
| − | color: #212121
| |
| − | }
| |
| − | .c95 {
| |
| − | height: 235pt
| |
| − | }
| |
| − | .c34 {
| |
| − | font-weight: 700
| |
| − | }
| |
| − | .c99 {
| |
| − | margin-left: 72pt
| |
| − | }
| |
| − | .c80 {
| |
| − | height: 18pt
| |
| − | }
| |
| − | .c17 {
| |
| − | font-size: 12pt
| |
| − | }
| |
| − | .c78 {
| |
| − | padding-top: 14pt
| |
| − | }
| |
| − | .c102 {
| |
| − | font-size: 8pt
| |
| − | }
| |
| − | .c24 {
| |
| − | margin-left: 35.5pt
| |
| − | }
| |
| − | .c39 {
| |
| − | text-align: center
| |
| − | }
| |
| − | .c56 {
| |
| − | margin-left: 18pt
| |
| − | }
| |
| − | .c68 {
| |
| − | vertical-align: super
| |
| − | }
| |
| − | .c88 {
| |
| − | text-align: right
| |
| − | }
| |
| − | .c85 {
| |
| − | color: #0000ff
| |
| − | }
| |
| − | .c22 {
| |
| − | margin-left: 36pt
| |
| − | }
| |
| − | .c55 {
| |
| − | text-decoration: underline
| |
| − | }
| |
| − | .c84 {
| |
| − | height: 16pt
| |
| − | }
| |
| − | .c31 {
| |
| − | padding-bottom: 0pt
| |
| − | }
| |
| − | .c36 {
| |
| − | font-size: 36pt
| |
| − | }
| |
| − | .c92 {
| |
| − | text-align: justify
| |
| − | }
| |
| − | .c53 {
| |
| − | text-align: left
| |
| − | }
| |
| − | .c75 {
| |
| − | height: 12pt
| |
| − | }
| |
| − | .c48 {
| |
| − | line-height: 1.15
| |
| − | }
| |
| − | .c93 {
| |
| − | line-height: 1.0
| |
| − | }
| |
| − | .c43 {
| |
| − | color: #70ad47
| |
| − | }
| |
| − | .c19 {
| |
| − | background-color: #ffffff
| |
| − | }
| |
| − | .c105 {
| |
| − | line-height: 1.1500000000000001
| |
| − | }
| |
| − | .c59 {
| |
| − | font-size: 16pt
| |
| − | }
| |
| − | .c82 {
| |
| − | font-size: 9pt
| |
| − | }
| |
| − | .c70 {
| |
| − | color: #222222
| |
| − | }
| |
| − | .c65 {
| |
| − | padding-top: 0pt
| |
| − | }
| |
| − | .c29 {
| |
| − | text-indent: 36pt
| |
| − | }
| |
| − | .title {
| |
| − | padding-top: 0pt;
| |
| − | color: #000000;
| |
| − | font-size: 26pt;
| |
| − | padding-bottom: 6pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: right
| |
| − | }
| |
| − | .subtitle {
| |
| − | padding-top: 0pt;
| |
| − | color: #666666;
| |
| − | font-size: 10pt;
| |
| − | padding-bottom: 36pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.0;
| |
| − | page-break-after: avoid;
| |
| − | font-style: italic;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: right
| |
| − | }
| |
| − | li {
| |
| − | color: #000000;
| |
| − | font-size: 10pt;
| |
| − | font-family: "Calibri "
| |
| − | }
| |
| − | p {
| |
| − | margin: 0;
| |
| − | color: #000000;
| |
| − | font-size: 10pt;
| |
| − | font-family: "Calibri "
| |
| − | }
| |
| − | h1 {
| |
| − | padding-top: 15pt;
| |
| − | color: #000000;
| |
| − | font-size: 16pt;
| |
| − | padding-bottom: 2pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h2 {
| |
| − | padding-top: 0pt;
| |
| − | color: #000000;
| |
| − | font-size: 14pt;
| |
| − | padding-bottom: 0pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h3 {
| |
| − | padding-top: 0pt;
| |
| − | color: #000000;
| |
| − | font-size: 12pt;
| |
| − | padding-bottom: 0pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h4 {
| |
| − | padding-top: 0pt;
| |
| − | color: #000000;
| |
| − | font-size: 11pt;
| |
| − | padding-bottom: 0pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | font-style: italic;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h5 {
| |
| − | padding-top: 0pt;
| |
| − | color: #538135;
| |
| − | font-size: 14pt;
| |
| − | padding-bottom: 0pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | h6 {
| |
| − | padding-top: 0pt;
| |
| − | color: #70ad47;
| |
| − | font-size: 11pt;
| |
| − | padding-bottom: 0pt;
| |
| − | font-family: "Calibri ";
| |
| − | line-height: 1.1500000000000001;
| |
| − | page-break-after: avoid;
| |
| − | orphans: 2;
| |
| − | widows: 2;
| |
| − | text-align: left
| |
| − | }
| |
| − | </style>
| |
| | | | |
| − | | + | </div> |
| − | <div class="c19 c98 "> | + | <br><br> |
| − | <p class="c4 c14 title "><span class="c3 c51 c36 "></span>
| + | <a href="https://static.igem.org/mediawiki/2016/f/ f1/T--UofC_Calgary-- biotargetjournal. pdf"< center><p style=" text- align: center">< font-size="4"> Click here to view the above PDF</p></ font></ center></a> |
| − | </p>
| + | </div> |
| − | <p class="c4 c14 title "><span class="c3 c51 c36 "></span>
| + | <!-- END: CONTENT/MISC/ABOUT-1 --> |
| − | </p>
| + | <!-- BEGIN: CONTENT/MISC/ABOUT-1 --> |
| − | <p class="c4 c14 title "><span class="c3 c51 c36 "></span>
| + | <div class="c-content-box c-size-md c-bg-white" id="second"> |
| − | </p>
| + | <div class="container"> |
| − | <p class="c4 c14 title "><span class="c3 c51 c36 "></span>
| + | <div class="col-md-12"> |
| − | </p>
| + | <!-- Begin: Title 1 component --> |
| − | <p class="c4 c14 title "><span class="c3 c51 c36 "></span>
| + | <div class="c-content-title-1"> |
| − | </p>
| + | <a href="https://static.igem.org/mediawiki/2016/3/ 30/T--UofC_Calgary-- chassisjournal. pdf"><h3 class="c-font-uppercase c-font-bold"> Chassis Notebook</ h3></ a> |
| − | <p class="c4 c14 c92 title "><span class="c3 c51 c36 "></span>
| + | <div class="c-line-left c-theme-bg"></a> |
| − | </p>
| + | |
| − | <p class="c4 title "><span class="c3 c36 ">Device’s NOTEBOOK</span>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">About Us</span></h1>
| + | |
| − | <h2 class="c4 c100 "><span class="c3 c34 c17 c43 ">Address: UOFC_CALGARY IGEM 2016</span></h2>
| + | |
| − | <p class="c6 "><span class="c1 ">UNIVERSITY OF CALGARY</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">HM393B - 3330 HOSPITAL DRIVE, NW</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">CALGARY, AB T2N 4N1</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">CANADA</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h2 class="c4 c100 " id="h.17c9hp7vvxgk "><span class="c3 c34 c17 c43 ">CONTRIBUTORS:</span></h2>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c39 c31 " id="h.i1jk585k7bns "><span class="c3 ">Mathematical Modelling/Academics</span></h3>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Noshin Karim</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Neliza Mendoza</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">David Nguyen</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c39 c31 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c39 c31 " id="h.lzv2lhy8cq9f "><span class="c3 ">Manufacturing/External affairs</span></h3>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">David Nguyen</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Neliza Mendoza</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c39 c31 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c39 c31 " id="h.gmglmt8a3szt "><span class="c3 ">Visual Modelling/Graphic Designer</span></h3>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Christine Phan</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Tiffany Dang</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c39 c31 "><span class="c3 c16 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c39 c31 " id="h.rb9ki0mzw88x "><span class="c3 ">Team Lead/Lab Technologist</span></h3>
| + | |
| − | <p class="c18 c39 c31 "><span class="c16 c3 ">Tiffany Dang</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c39 c31 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c39 c93 " id="h.fiootgyqn60d "><span class="c3 ">Administrative</span></h3>
| + | |
| − | <p class="c12 c39 "><span class="c16 c3 ">Tiffany Dang</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c39 "><span class="c16 c3 ">Noshin Karim</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c39 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c31 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c63 c3 c59 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Considerations</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 c34 c17 c43 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 "><span class="c3 c34 c17 c43 ">What we have to determine:</span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, May 4th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">How effectively diffusivity works</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Scaling:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Model and prototype</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Measurements</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Layers:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Kill switch in backing layer and bottom layer </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Break controller</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Know how long proteins would stay in the body</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c56 "><span class="c3 c13 "> </span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, May 6th </span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Habitation:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Reservoir/chamber </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Control temperature</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Oxygen permeability </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Specific parts of the body (heat, placement)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Delivery of nutrients - snapping mechanism?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Modelling - in different conditions, see the growth rate </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Entire Device:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Design</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Materials - contaminants</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Eg) rate controlling membranes, diffusion of peptides </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Interface:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Needle - size, density, material, design</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Compatibility - initiation</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Site of application </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Disinfect prior to use, etc. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c11 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, May 20th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_25-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">General</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_26-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">How to apply to body?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">How to discard after use (i.e. when we take it out, won’t the media start to leak?)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_26-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Microneedles/Drug Reservoir</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_26-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">How to deliver drug through microneedle? (frozen, snap mechanism, isotonic?)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Hollow needle location → side or straight down?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">What to test? (strain, stress, flow rate, diffusivity, etc.)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">How to construct everything on a small scale? </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Can we build a microneedle based on our own dimensions (i.e. can we customize the microneedle)? Or are the dimensions preset because we are ordering them in?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Backing layer → is that included in the microneedle or do we need to attach it on?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Actually getting microneedles</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">What is in the drug reservoir? (bacteria, nutrients (LB = nutrients))</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Can we build on a microscopic scale? If so, how?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">What is the media that is in the microneedle?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">How do traditional microneedles work?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Snapping mechanism</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_26-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Size-controlling membrane</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_26-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">How big should the pores be? (0.1 micrometer or smaller… 0.1 = size before bacteria can go through) → what else other than peptides will go into the body? Will they be harmful?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">What material should it be made of? What else do we need to consider for the membrane (flexibility, etc.)?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">How do we get it? (3M)?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Can we cut it to get it in a certain size?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c99 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, May 25th</span></h3>
| + | |
| − | <p class="c6 "><span class="c30 c16 c3 c19 ">When researching materials, consider the following:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_29-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c19 c30 ">cost</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">environmentally friendly</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">the “biological aspects” (e.g. gas/oxygen permeability, elasticity permeable)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">how can we get the material (local, international)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">think about how can we use the material to assemble the device (e.g. if we need silicon for the device for example, is it easily machined?)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, May 31st</span></h3>
| + | |
| − | <p class="c6 "><span class="c1 ">****The patch has to be</span><span class="c16 c3 c13 c34 "> transparent</span><span class="c1 "> so that the indicator can be noticeable</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, June 6th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_51-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">How to make the patch</span><span class="c16 c3 c13 c34 "> long term</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_51-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Look at disposable</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Space the package would take</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Shelf life, how long would it take for the patch contents to "expire”</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_51-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Think about the worse scenarios that we could get</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_51-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Then we can start thinking about alternatives</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">100 mL vs. 10 mL</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Packets being unintentionally popped</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_51-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Actually have a plan, but it is also important to know how everything works out</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c63 c3 c59 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Designs</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, May 9th </span></h3>
| + | |
| − | <h4 class="c4 "><span class="c3 ">Design of Microneedles:</span></h4>
| + | |
| − | <ul class="c2 lst-kix_list_5-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Hollow cylindrical microneedle with conical tip </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Enough strength to withstand bending and axial forces</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Pressure uniform in main cavity of needle </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Velocity constant in cavity; increase in outlet</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Flow rate controlled by applied pressure and diameter of hole </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">For different materials - strength and deformation compared </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c56 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Design 1:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_6-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The microneedle - from the machine shop</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Semipermeable membrane - use a filter (different grades of filter paper)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Bacteria?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">A top layer (to the bacteria)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Design 2:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Part 1: MICRONEEDLE</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_7-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The microneedle - from machine shop</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Semipermeable membrane - use a filter (use different grades of filter paper)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Part 2: CAPSULE WITH BACTERIA</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_8-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Capsule with bacteria - the capsule can be put in the fridge; after, it would be inserted into the microneedle and then using a snapping mechanism/force to break the capsule which starts the process and peptides go through the semipermeable membrane</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, May 17th</span></h3>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Device Prototypes:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_14-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 c46 ">Major idea #1: Bacteria, rich media (LB), membrane all in top of drug reservoir </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 174.53px; height: 130.93px; "><img alt="https://lh5.googleusercontent.com/hfUPu8YrWJxq--cd1ZWg0GVcXpfXV0UyK-sa5lZCxKPkEdYoHyadskkzR0jMyQ835cw1uHPwgyx-rgdCRuxbKWZIKvOv2bi_s_ygEMkt_H97Y3ZAYZb2eH2xlzsFY1QY3lGX0BKc " src="https://static.igem.org/mediawiki/2016/4/4b/T--UofC_Calgary--image16.png " style="width: 174.53px; height: 130.93px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_15-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Variations of Major idea #1</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_15-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Patch on top of microneedle array (patch is directly on top of patch)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 183.27px; height: 111.02px; "><img alt="https://lh4.googleusercontent.com/lxSmEKFW3l2YMFL9-hmJQ281dsRzydFEJi19Jbsy2YIJxBMYiVY-A84XVB1hO1kLU-hHXro-NLL_pxI6hIXfnnnXv6c7bb_2DTqI3F-IoMVWzDpA1m9M-tZcM3eMD8cpuusz-24X " src="https://static.igem.org/mediawiki/2016/3/3d/T--UofC_Calgary--image18.png " style="width: 202.00px; height: 123.00px; margin-left: -6.24px; margin-top: -3.74px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_16-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Drug reservoir right on top of needles (i.e. no patch) and size controlling membrane </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_16-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Problems: How can we actually put in things in this small drug reservoir?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c3 c17 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 182.40px; height: 124.80px; "><img alt="https://lh3.googleusercontent.com/V7EYi-Ux8NAMnNr7EGec68yjSS9t7SF7U9IzDIMVkSXErxXzilEjzqeVHWWedbd6BRA7v2loqfoUIHlkMO45rFFvgn-JlPVv316AT-yvQgL8rwe_gIQ2O4Hl_IlAdi-m_rV8ClSP " src="https://static.igem.org/mediawiki/2016/9/90/T--UofC_Calgary--image17.png " style="width: 182.40px; height: 124.80px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_17-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Drug reservoir right on top of needles – media is initially frozen and then melted after application to body due to body heat</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_17-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Problems: can’t make the media frozen because expensive (buy refrigerator)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Frozen media will also expand like water, so when it melts it may not come into contact with spores</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 182.40px; height: 163.20px; "><img alt="https://lh6.googleusercontent.com/WBWIoUltBy25UADG0T2fxz92aCI4N85sI1TAuM9jrzroWT9lFrPc64rGD5G0MBdU_PNRIgvYe2EYaQhhdxpPN2OYWWQkIn6d01SmRj0Hb3WAfmZxtsLLU7W2rX3w4O3fQ4rUrveI " src="https://static.igem.org/mediawiki/2016/a/a8/T--UofC_Calgary--image20.png " style="width: 182.40px; height: 163.20px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_18-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">1 packet containing the bacteria in the drug reservoir → snap the packet to release bacteria spore </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_18-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Problems: How can we actually put spores in small packets and then put them in the small drug reservoir? How can we break those packets?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 134.40px; height: 172.80px; "><img alt="https://lh3.googleusercontent.com/eA7WpsW7Sr6OUPl5cDPPpb9Z8edWt4im0f571AJiQlwwnf4FtgERUC8js-8tgMn8u9jtgXtYS0TLE1kLjRSZvFCisMDItPQpx_4F068rW3AQ38kA4kwi0vKpfxA7r37rAmRVuK1Z " src="https://static.igem.org/mediawiki/2016/a/a1/T--UofC_Calgary--image19.png " style="width: 134.40px; height: 172.80px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_19-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Introduction of a gel (on a “lid”/backing layer that is lowered onto the top of the microneedle array/drug reservoir) OR rate controlling membrane (hence we have a rate and size controlling membrane)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_19-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Problems: How do we put a lid on the top of the microneedle array? How do we stick the gel on the lid? If the gel falls, won’t it block the size controlling membrane? How do we put a rate controlling membrane in the small microneedle array?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c3 c17 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 202.00px; height: 160.80px; "><img alt="https://lh5.googleusercontent.com/3gKpz1cZJAeqnE-5NipZFMa4HOgtEktOPP_jn8kG7n2m42e9M7dlC6QNYx9pPEbMDQkuHO7EK3BUcaiyEyvDrASGPcNypYhPKx9Uxq5SJd7l1jzOSs1ismmrb4wHb_0sKMBQjL-l " src="https://static.igem.org/mediawiki/2016/8/8e/T--UofC_Calgary--image22.png " style="width: 202.00px; height: 160.80px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_20-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 c46 ">Major idea #2: Leave microneedle as it is; have larger patch that contains 2 chambers to separate LB and spores</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 183.41px; height: 124.49px; "><img alt="https://lh5.googleusercontent.com/zzzX_cBjZ6DI91BcDIjbfGruvmtiGL2t5ZiwA6LRPWUS_W_edsVwKRPKS7nFuy_Y9SkofbSDaU03XE1NmiWriYu0wfNkdzDIz-eL3CRitLaVDUadgK4H1YZtLJFaW_uKqT-KvHaL " src="https://static.igem.org/mediawiki/2016/2/2c/T--UofC_Calgary--image21.png " style="width: 183.41px; height: 124.49px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_21-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">backing material (what the block is made of)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">“valve”</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">size controlling membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">adhesive layer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">microneedles</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Constraints:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_22-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">70 degrees C to activate spores</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Oxygen transmission: available (80-100 cc/m2/24h)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h4 class="c4 "><span class="c3 ">Dr. Dalton’s Microneedles </span></h4>
| + | |
| − | <ul class="c2 lst-kix_list_31-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 c34 ">Problem 1</span><span class="c1 ">: Geometry of microneedles</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">TIP: </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Insertion force can be independent of the wall thickness</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Fracture force increases with increasing wall thickness and increases with wall angle, also independent of tip radius</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Side opened microneedles instead of standard tip microneedles – prevents tissue clog during insertion</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">High needle density can increase fluid flow rate </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Sharper needles require less force for insertion, but has reduce needle tip strength </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Microneedle needs to be 10-15 um but shorter than 50-100 um to avoid pain </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Best option: small tip radius, large wall thickness</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">BODY:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Cylinder: eliminate stress concentrations, stronger needle structure, better self-adhesion</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 c34 ">Problem 2</span><span class="c1 ">: Material for microneedles</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Single crystalline silicon: high resistance to bending, can be fragile</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Metal – greater strength, but thin metals are soft </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 c34 ">Problem 3:</span><span class="c1 "> Application/removal</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Application: Elastic nature of skin creates possibility of non-uniform contact of the array with the skin - an issue for correctly metering dosages</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Has to find out which area of the skin where the least strain happens</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Removal: Leakage when microneedle patch is removed</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_31-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Development of microvalves within microneedles = passive system</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c3 c34 c82 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 "><span class="c3 c34 c82 ">Reference: </span><span class="c3 c82 ">Ashraf, M., Tayyaba, S., Nisar, A., Afzulpurkar, N., Bodhale, D., & Lomas, T. et al. (2010). Design, Fabrication and Analysis of Silicon Hollow Microneedles for Transdermal Drug Delivery System for Treatment of Hemodynamic Dysfunctions. </span><span class="c3 c26 ">Cardiovascular Engineering</span><span class="c3 c82 ">, </span><span class="c26 c3 ">10</span><span class="c3 c82 ">(3), 91-108. </span><span class="c54 c3 c102 "><a class="c28 " href="https://www.google.com/url?q=http://dx.doi.org/10.1007/s10558-010-9100-5&sa=D&ust=1475963638124000&usg=AFQjCNHg0ExvHGrVqS3yp6bsAHuKH8VVWA ">http://dx.doi.org/10.1007/s10558-010-9100-5</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c1 "><a class="c28 " href="https://www.google.com/url?q=http://dx.doi.org/10.1007/s10558-010-9100-5&sa=D&ust=1475963638126000&usg=AFQjCNGjTB_eWuA9nZDgWsnSWYsLjizFEw "></a></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, May 9th </span></h3>
| + | |
| − | <h4 class="c4 "><span class="c3 ">Future design testing:</span></h4>
| + | |
| − | <ul class="c2 lst-kix_list_9-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Test the proposed design with skin (animal skin?)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Change diameter of hole - how much more different is the flow </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Heat of finger - enough to stimulate it?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Diffusion works?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Failure load (at what pressure does the needle break?)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h4 class="c4 "><span class="c3 ">STORAGE IDEA 1: Freeze drying</span></h4>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 ">Order in microneedles > put in freezer > at temperature of freeze dry</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 ">If microneedles survive in the fridge, we should also test if diffusivity still works</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c3 ">If diffusion did not work, we have to look at pumps</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 ">Membrane/Filter test: does the drug reservoir/peptide actually go through the filter? Does it prevent the bacteria from going through? </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c3 ">Diffusion test: To test whether diffusion will actually work and what other problems we will face with diffusion (e.g. bacteria secretes peptides which go through the semipermeable membrane… but what about the media that goes through the membrane?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c3 ">Making changes to the design</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 ">Is the drug reservoir actually contained properly in the microneedle?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_1-0 ">
| + | |
| − | <li class="c27 c18 c8 "><span class="c3 ">Bacteria test</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, May 16th</span></h3>
| + | |
| − | <h5 class="c4 "><span class="c3 ">Experiment to somehow test the idea:</span></h5>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Objective:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Tested the level of frozen H2O in microneedle as it melts into a cup of H2O (l)</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Materials:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_11-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">200 uL pipet tip </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Distilled H2O</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">200 uL pipetter</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Freezer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">300 uL H2O</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Parafilm/tape</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Black sharpie </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Test tube rack </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 c46 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Procedure:</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_12-0 start " start="1 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">We used a pipet to take in 150 uL of distilled water in a pipet tip and taped the bottom with parafilm/tape. We marked the water level with a black sharpie.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Put the pipet tip in freezer and let the H2O freeze (10:50 am - after lunch).</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Put pipet tip (just the tip area) into test tube of 300 uL (2x the volume of water in the needle). Cap the top with parafilm. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Overtime, see whether amount of H2O (l) goes back to original height.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 c14 c22 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Results/Observation:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">After putting the frozen water in the distilled H2O (l) test tube (at normal tap temperature), we put parafilm on top to mimic the microneedle being capped. </span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_13-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">H2O melts extremely fast (this is without adding body heat) - melted within 1-2 minutes </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">In actual microneedle, H2O (s) will melt very fast due to body heat. Also, silicon vs. plastic tube</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">After melting we noticed H2O (l) level in needle is at a constant level (significantly lower than initial amount). Eg) doesn’t go back to original level </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">H2O did expand, but not too significantly from initial observation, we think it won’t affect/damage the needle tip </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, May 9th </span></h3>
| + | |
| − | <h4 class="c4 "><span class="c3 ">IDEA 2: Popping Idea</span></h4>
| + | |
| − | <ul class="c2 lst-kix_list_10-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Instead of pump, have a chamber with cells have a positive pressure already within it - have it sealed </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Capsule - look into the 2014 team </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Thinking about having water in the capsule, keep water in capsule, break it and everything gets hydrated </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Coating the microneedles with palmitic acid, we don’t need to create another compartment </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">For medical uses, need only single administration, would we need the bacteria there? Could dissolving microneedles work?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, June 6th </span></h3>
| + | |
| − | <p class="c12 "><span class="c3 c13 c34 c55 ">Tentative Materials for Our Patch</span>
| + | |
| − | </p>
| + | |
| − | <a id="t.d7e873a4f0ebb5ffe45155d50d4634e2f95e223c "></a>
| + | |
| − | <a id="t.0 "></a>
| + | |
| − | <table class="c87 ">
| + | |
| − | <tbody>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c60 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 c34 ">Part of the patch</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c86 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 c34 ">Material</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c49 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 c34 ">Pros</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c71 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 c34 ">Cons</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c95 ">
| + | |
| − | <td class="c60 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Backing Layer</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Purpose: </span><span class="c3 c19 c70 "> </span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c19 c70 ">provides structural support and protects the middle adhesive layer from the environment</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c86 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 c34 ">3M CoTran™ 9722 Backing Polyethylene Monolayer Film<br><br></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Alternative: (2nd best out of 3)</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M CoTran™ 9719 Backing Polyethylene Monolayer Film<br></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c49 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Out of the three films 3M offers, the qualities that we thought would be beneficial are:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_60-0 start ">
| + | |
| − | <li class="c12 c79 c15 "><span class="c9 c3 ">Elongation = for movement of patient, has to 600% elongation, highest of the three</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c15 c79 "><span class="c9 c3 ">MVTR = this has the lowest amount out of all 3</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Translucent</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Breathable</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Printable</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Can be directly laminated to adhesives</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Heat Sealable (PE)</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c15 c76 "><span class="c3 c13 ">Designed to resist excipient and drug uptake</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c71 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">We are not sure how much oxygen the bacteria would be using. We are not sure if 6400 cc/m</span><span class="c3 c13 c68 ">2</span><span class="c3 c13 ">/day is enough for oxygen transmission.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">We do not know if this would turn cloudy after a period of time as currently existing patches with clear backing undergo the same issue.</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c60 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Adhesive Layer</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Also note that thicker adhesive layer also results in severe cold flow during storage in the pouch, and</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">higher affinity for lint and dirt to adhere to the edge of the</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">patch during wear.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c86 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c18 c15 c14 c96 c93 "><span class="c9 c3 "><br><br></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c54 c3 "><a class="c28 " href="https://www.google.com/url?q=http://na.henkel-adhesives.com/us/content_data/330922_11061_LT5343_Product_selector2_Web863600.pdf&sa=D&ust=1475963638177000&usg=AFQjCNG-q4G_E1kdZtA2ItagKUCuws3neA ">pdf of Duro-Tak Transdermal Adhesives</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "><a class="c28 " href="https://www.google.com/url?q=http://na.henkel-adhesives.com/us/content_data/330922_11061_LT5343_Product_selector2_Web863600.pdf&sa=D&ust=1475963638178000&usg=AFQjCNFtVIxN5Bed85T4jKPdDhUGtcPgxg "></a></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c49 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "><a class="c28 " href="https://www.google.com/url?q=http://na.henkel-adhesives.com/us/content_data/330922_11061_LT5343_Product_selector2_Web863600.pdf&sa=D&ust=1475963638180000&usg=AFQjCNE_2jIZUSnkDXQoodvaazS5Gy9ZYw "></a></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c71 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "><a class="c28 " href="https://www.google.com/url?q=http://na.henkel-adhesives.com/us/content_data/330922_11061_LT5343_Product_selector2_Web863600.pdf&sa=D&ust=1475963638181000&usg=AFQjCNH2vAcoBoKLh_nOKyE4qZOhMJlhmg "></a></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c60 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Release Liner</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c86 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M Scotchpak 1022</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M Scotchpak 9741</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M Scotchpak 9742</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M Scotchpak 9744</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">3M Scotchpak 9755</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c49 " colspan="1 " rowspan="1 ">
| + | |
| − | <ul class="c2 lst-kix_list_61-0 start ">
| + | |
| − | <li class="c12 c8 c15 "><span class="c9 c3 ">Good for release with silicon skin contact adhesives, acrylate, PIB and rubber based PSA</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_62-0 start ">
| + | |
| − | <li class="c12 c8 c15 "><span class="c9 c3 ">Excellent chemical stability</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | </td>
| + | |
| − | <td class="c71 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 c14 "><span class="c3 c9 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c60 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c3 c13 ">Size-controlling membrane</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c86 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c9 c3 ">tentative</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c49 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c71 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 c14 "><span class="c9 c3 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | </tbody>
| + | |
| − | </table>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Important Notes</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, June 20th </span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_75-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Emailed 3M for </span><span class="c16 c3 ">products</span><span class="c1 ">, will </span><span class="c16 c3 ">talk</span><span class="c1 "> </span><span class="c16 c3 ">to</span><span class="c1 "> them tomorrow if they haven’t replied.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_75-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Got a reply from 3M. Will need to call them later to ask for</span><span class="c16 c3 "> products</span><span class="c1 ">.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_75-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Emailed Dow Corning for adhesives</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Emailed Dr</span><span class="c16 c3 ">. </span><span class="c1 ">Nezhad, an Electrical Engineering prof whose research is focused on microfluidics, for meeting</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 ">Researched about different assays for material testing</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, June 27th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_74-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contacted 3M again, they are sending us the samples (YES). They should be here by the end of next week.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Dow Corning will send the adhesives on 29th of June</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Today the device team focused on the math model for diffusion as weird numbers for the initial amount of peptides that needs to be produced have been calculated. Noshin found a paper with a MATLAB code that can be used to calculate the diffusion across a membrane using Fick’s second law of diffusion. An email was sent out to Dr. Nygren to get his opinion on the code and see if we are heading in the right direction</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">UPDATE: We meet with Dr. Nygren Wednesday to go over the mathematical model developed. He suggested in his email that </span><span class="c16 c3 c51 c97 c19 ">the equation is applicable in principle, but the situation is a little different because the membrane and skin surface are probably the main diffusion barriers and the diffusion constant is (very) different at those barriers compared to everywhere else. He also suggest we create a numerical method rather than doing it analytically. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, June 28th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_76-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The device group continued to work on both learning Solidworks to build the graphical model as well as the mathematical model of the diffusion of BBI through the patch, skin and into the </span><span class="c16 c3 ">bloodstream</span><span class="c1 ">.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c8 "><span class="c16 c3 ">From our results we calculated that we need 2 g of peptide being produced in the patch. This however is not feasible and needs to be reworked. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, June 29th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_78-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Protocols Tiff and Dave talked about with Dan</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_78-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Test how much media go through and if peptides go through; safety mechanism</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Can we make dye as a qualitative or quantitative aspect of the assay?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">How do we confirm peptides make it through?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Critical: make sure cells stay where they are, and peptides go through</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_77-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">There may be a big difference in terms of the diffusion constants depending on the volume, barriers, material</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Dr. Nygren’s suggestions</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_77-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">DRAW</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Volumes separated by membranes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Faster production = would reach steady state at some point as too much BBI might stop bacteria from producing</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Work equations out that he derived; make sure units are consistent</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Degradation - might be in the bloodstream, not before the skin</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Diffusion coefficients: testing would be necessary for peptide flow through membrane; for skin, could probably find from literature; or ask yourself, can we just find the diffusion coefficients rather than testing bunch of membranes?</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">In our case diffusion is too fast that equilibrium is achievable.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Make sure to state assumptions and a way to justify it.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c47 "><span class="c3 c13 ">MATLAB: solving ODEs; recall ENGG 407 lecture</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, July 5th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_79-0 start ">
| + | |
| − | <li class="c12 c8 c78 "><span class="c16 c3 c13 ">The rest of the team continued to work on the diffusion model based on Dr. Nygren’s suggestions. Based on Noshin’s work, there were too many unknowns that we could solve for if we decided to solve the equation as a function of time. Therefore we went back to Fick’s first law where the diffusion was a function of concentration over area. This however had unknowns such as protein solubility that we weren’t sure of</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 c65 "><span class="c16 c3 c13 ">Adhesive? Gave the green light that the assays are doable</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_79-1 start ">
| + | |
| − | <li class="c12 c21 c65 "><span class="c16 c3 c13 ">Backing Layer? Gave a similar opinion that the assays are doable</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c65 "><span class="c16 c3 c13 ">Membrane? REASONABLE</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c65 "><span class="c16 c3 c13 ">Quantifying about how much peptide go through</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c65 "><span class="c16 c3 c13 ">Use of other peptides? (Since we want to quantify diffusion, maybe we could use something that is cheaper)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c65 "><span class="c16 c3 c13 ">TRICKIEST: finding how much went through</span>
| + | |
| − | </li>
| + | |
| − | <li class="c61 c18 c21 c65 "><span class="c16 c3 c13 ">Glucagon, oxytocin (20 - 30 amino acids long)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, July 13th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_88-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contacted Dr. Nezhad about manufacturing patches, asked for resources.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contact Dr. Ingalls from Waterloo.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Update: Waterloo is open for collaboration.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">In terms of modelling:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_88-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Had our equations sent to Brian Ingalls for checking.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_88-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Christine developed the patch using SolidWorks! See below:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 240.74px; height: 218.59px; "><img alt="https://lh6.googleusercontent.com/95luN5VY1DQPEEZn6xdFivH9KrqA7sj3n81vc-wQQU5MMjOetj2M9ZvWvwGWyA4SzEA7nRSNAEH5oTWasxB2w0q4ZvqCLHbjPUblIF0iQ629ejJ2BVjple0vZJeL0K1pvXeV51Ku " src="https://static.igem.org/mediawiki/2016/f/f8/T--UofC_Calgary--image24.png " style="width: 240.74px; height: 218.59px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, July 14th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_89-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Dr. Sundararaj (UT) next thursday the 21st at CCIT 320 at 1 pm for manufacturing.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Finished the analytical diffusion model across stratum corneum. See Device folder >> Patch Modelling >> open the only document there >> See Stratum corneum under Layer by Layer heading.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany finished her initial models for the bottom layer of the patch</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_89-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Optimized the dimensions to hold 10 mL in the main area, and either 0.5 and 1 mL of media in the pockets</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Sent the models into 3D printing services at TFDL <3</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Will hear back in a couple of business days about the progress</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c14 "><span class="c3 c13 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, July 15th</span></h3>
| + | |
| − | <p class="c12 "><span class="c3 c13 ">Team Meeting</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_89-1 ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Nelly has finished the first part of the analytical model for the stratum corneum. She will continue working on the next two parts of the analytical model for the next week</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Dave has been researching ways to manufacture to create the patch. For most industries including 3M they will only manufacture for large scale industry</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">As a result Dave is focussing on how to manufacture our patch ourselves or with some professors</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Nelly will help out with Dave with this by researching into the adhesive and how to attach it</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Both Nelly and David have contacted professors for help in manufacturing the patch. We have a meeting with Dr. UT next Thursday at 1:00 pm with David, Nelly and Tiff</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">If worse comes to worse and no one can help us, we are visiting the machine shop to see if anyone can help us</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Christine and Tiff have finished their prototypes. Tiff has sent hers to get 3D printed and will hear back in a couple of business days about the progress</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Christine and Tiff will start David’s assay next week and run triplicates throughout the week to see if the patch growth curves matches the ones under optimal conditions already done in the lab</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Discussed with Nishi what needs to be done for mouse trials</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_89-2 start ">
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">There are three trials being run: 6 mice for a positive and negative control, 6 mice with patches with BBI dissolved in DMSO, and 6 mice with patches with cell culture</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">The patch is 1 cm X 1 cm X 0.2 cm</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">The patches need to be completed Monday prior the experiments begin the following Monday</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_89-1 ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Alina also messaged back Tiff to see how things were going</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_89-2 start ">
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">She will be escorting an astronaut from the Apollo 11 mission during a science fair and so we can send her questions we can ask the astronauts that will be there</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">Tiff will create a document for questions to send to Alina. Focus the questions on either radiation in space or their lifestyles in space</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c47 "><span class="c16 c3 c13 ">As well she said she will try to help us with our model. She said to message her as a group if we have questions about the diffusion model. Currently she is working on her own MATLAB project and she said could help us with this aspect specifically </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c27 c18 c39 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 238.56px; height: 173.82px; "><img alt="Prototype_Christine.jpg " src="https://static.igem.org/mediawiki/2016/e/ee/T--UofC_Calgary--image23.png " style="width: 410.25px; height: 230.94px; margin-left: -93.47px; margin-top: -47.55px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span><span class="c3 c13 c34 "> </span><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 273.91px; height: 174.47px; "><img alt="Prototype_Tiffany.jpg " src="https://static.igem.org/mediawiki/2016/1/15/T--UofC_Calgary--image27.png " style="width: 340.97px; height: 196.71px; margin-left: -30.67px; margin-top: -20.44px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c32 c14 c61 "><span class="c3 c13 c34 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, July 19th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_90-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">This is what Nelly did for the whole day: </span><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://docs.google.com/document/d/1A2AMvbQ-WpV2omq_BrXjgnSq91J7drtvspDCaXYtqpc/edit?usp%3Dsharing&sa=D&ust=1475963638227000&usg=AFQjCNH6V3sGJ6_lVCh_pcVNncax4I8FIw ">Check this out</a></span><span class="c1 ">. She tried to organize all the models she had on file into a document. Hopefully it is easier to navigate in this format. She also uploaded all the codes, functions, scripts etc. She uploaded it in a folder under Patch Modelling.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Followed up with Dr. Nezhad because he has not responded for 6 days.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Finished first draft of the powerpoint about our project. Check *presentation under *device for it.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany talked to Dr. Mayi concerning optimizing the diffusion assay</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_90-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Instead of an eight hour interval of taking the sample, we will run the project over a seven day period, taking samples at 24 hour period to mimic the patch.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c16 c3 c13 ">As well, we are now measuring the the optical densities over a spectrum as no literature points to a wavelength for saline solution/distilled water</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, July 20th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_91-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Tiffany continued working on the diffusion assay and got initial results to determine the wavelength needed to determine the optical density of saline solution</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_91-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">The falcon tubes containing LB, </span><span class="c46 c16 c3 c13 ">B. subtiliis </span><span class="c16 c3 c13 ">and </span><span class="c46 c16 c3 c13 ">E.coli </span><span class="c16 c3 c13 ">were removed from the saline solution</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Saline solution was used as a blank</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c21 "><span class="c16 c3 c13 ">Wavelengths of 260 nm, 300 nm, 600 nm, and 700 nm were used to measure the absorbance of the saline solutions contained in the erlenmeyer flask</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, July 27th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_96-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Went to the machine shop to see if they can help us manufacture patches for prototype testing. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_96-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Although they were not super clear about what we wanted initially they figured out the basics of what we needed from them</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">They took care of 3D printing for free for us as we are a student based project and they resolved the issues for us</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Tiffany is in contact with them and will hear back from them in a couple of days</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">In addition, we learned that the machine shop cannot manufacture the patch. What they do recommend is the easiest way would be to proceed with something similar to the thermoforming method</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_96-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">About the thermofolding method</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_96-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Suggested we cast a mold that they can help us design using metal. The mold would consist of two parts for the backing layer and the semipermeable membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">We would then heat our materials and lay them onto the molds to conform to their shape. From there we place the molds together and inject our media into the mold and heat seal the entire patch together </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Unfortunately they can only help us with the mold. They don’t have equipment we could use </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_96-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">We’re gonna talk to Dr. Mayi/Nygren before we proceed to see if this is a good idea and how we can proceed about thermoforming. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">We also need to determine experimentally at what temperature we get the two materials to seal together. This has to be determined ourselve</span><span class="c16 c3 ">s</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 ">Tiff will bring hair iron + blow dryer tomorrow to test at what temperature we can heat seal our materials </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, July 28th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_97-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The device team made prototypes today!</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_97-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">We used the flat iron, iron, and blow dryer. Iron worked best. See pic below!</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 225.00px; height: 155.34px; "><img alt="https://lh4.googleusercontent.com/83r22VBCFcCpmcATIgp2XtfMJeWXrfIsParzF8-_NDrXJ2vYyznjgSjS_KSxYprqehkaC7e4DiuwBWvwZ9t7RBklKE4bQipPKYPztWKjme-cF7dZiL4mZeVx7OcIa2j1fFGfKjbk " src="https://static.igem.org/mediawiki/2016/3/3d/T--UofC_Calgary--image25.png " style="width: 225.00px; height: 155.34px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_97-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly worked on her adhesives. She tested BIO-PSA 7-4101 and 7-4301; however, both tests failed. What she did on her first test was she applied a thin film of adhesive on the release liner and let the heptane evaporate. She waited for 20 minutes, but the adhesive dried completely that it lost its adhesive properties. She tried the second time and she waited for heptane to evaporate for 5 minutes. The adhesives still contained heptane. She would run tests again tomorrow for 10 and 15 minutes.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c22 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, July 29th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_99-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Had our weekly meeting. See timeline for what we have to accomplish next week.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">David contacted 3M to ask them to create a crude prototype so we have a better idea what the patch should look like.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly did rounds of her adhesive testing assays. She found that the BIO-PSA 7-4201 will be the best adhesive for our current purposes. BIO PSA 7-4101 dries up quickly as when it was applied, it lost it adhesiveness. BIO PSA 7-4301, on the other hand, dries up very slowly, which also explained why it is less viscous than the other adhesives. This means it is dissolved in more heptane. In the pic below, Nelly was holding onto the release liner, the other layer was our membrane. The adhesive was successfully stuck to the membrane.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_99-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Recommendations:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_99-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Use of rolling pin for more uniform adhesive distribution.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Wait 1.5 minutes for the adhesive to dry up once spread as film before attaching the membrane.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Test on pork skin. Design assays for quantifying amounts of adhesive we need to apply, optimal temperature for drying, etc.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">More prototypes next week!</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 216.05px; height: 162.61px; "><img alt="https://lh3.googleusercontent.com/60Jbhx61W9q0phjrvzfOfPHuYXWcV4dxcV-1ZhghSo9bPKKQzQZjwUAVJ5GeYHpxOmKN1JS9LxEMwTYxKTr-33ZRf-_lZ0rRSxXVEikifCTDmZenrfT0Q3dw6KCg2YGAaAuMZJFo " src="https://static.igem.org/mediawiki/2016/d/d2/T--UofC_Calgary--image26.png " style="width: 218.82px; height: 297.61px; margin-left: -2.77px; margin-top: -79.98px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, August 2nd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_100-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">David finished a detailed word doc outline of the presentation (with some help from Nelly and Tiff <3). Check under Presentation folder and edit anything you’d like. Now pass on to Christine to create powerpoint. Christine started a rough draft of our presentation. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">In the lab</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_100-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Tiff finished the last day of the diffusion assay</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Nelly and David performed some adhesive experiments. They experienced problems and they are as follow:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_100-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">The adhesive did not stick to the liner completely</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Uneven distribution of adhesive on liner</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, August 3rd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_101-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Christine did the data analysis for the diffusion assay</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 324.62px; height: 194.98px; "><img alt="https://lh6.googleusercontent.com/m3dDyIL1uE_GNFZynuFS_57Xnc1BJGEoSN5w7vITs-QOkYHEZy9837ILXqbXU_an8w16QSKXSrKa17pP6xI22sRsG2GASh13uxNLT-JUeHTGGK4mvKkIti_-aFy-TG4qdbwMaWqa " src="https://static.igem.org/mediawiki/2016/b/b7/T--UofC_Calgary--image28.png " style="width: 324.62px; height: 194.98px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 325.77px; height: 177.68px; "><img alt="https://lh5.googleusercontent.com/4gFPbGWT1reuLZK8HN57E-KCnMXxEjiWDldr7AmuH_yabV06PlLBESEDhZpxzoIdGfNYHL2PXv80iZWVNpO0ao6y_Cl_ooeJY_z-TKrPBusnURgjHufZRUy32x94SZHSJXHjgKwy " src="https://static.igem.org/mediawiki/2016/1/13/T--UofC_Calgary--image29.png " style="width: 325.77px; height: 177.68px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 323.65px; height: 176.53px; "><img alt="https://lh3.googleusercontent.com/y5qddRKtejlpUm3AehyuaxwNgsffpGnkSMhYKr4qIGjb6CYz94Dokop_C7CsuXofbUlPUSiSE3sNBPcfsCGAXX7eXI70q8xlbP3LjY5wyaZ1qGcSf61Hu15Mv-67Jt_TcQEpryz3 " src="https://static.igem.org/mediawiki/2016/3/3d/T--UofC_Calgary--image30.png " style="width: 323.65px; height: 176.53px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_102-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly and David are testing adhesive. There were different methods used in doing these tests. They are as follow:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ol class="c2 lst-kix_list_103-1 start " start="1 ">
| + | |
| − | <li class="c6 c57 "><span class="c16 c3 c13 c34 ">Rolling pin test</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_104-2 start " start="1 ">
| + | |
| − | <li class="c6 c24 c64 "><span class="c1 ">An amount of adhesive was applied to the release liner.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">A cut out of EVA membrane was placed onto the adhesive.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Place another layer of the release liner on the membrane to prevent the adhesives from sticking to the rolling pin.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Roll the pin on the layer to distribute adhesive.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Let it dry.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_104-1 start " start="1 ">
| + | |
| − | <li class="c6 c57 "><span class="c16 c3 c13 c34 ">Film application test</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_104-2 start " start="1 ">
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">An amount of adhesive was applied to the release liner. The adhesive must be applied I a straight line.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_105-2 start " start="1 ">
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Spread the adhesive using a popsicle stick to form a thin film.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Wait for a minute before placing a cut out of EVA membrane onto the release liner to dry</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_105-1 start " start="1 ">
| + | |
| − | <li class="c6 c57 "><span class="c16 c3 c13 c34 ">Two - release - liner - sandwiched - together test</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 c24 "><span class="c1 ">An amount of adhesive was applied to the release liner. The adhesive must be applied in a spiral manner.</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_106-2 start " start="1 ">
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Place another layer of the release liner onto the initial liner.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Spread the adhesive using a rolling pin, by pressing, etc. until you see a clear film (meaning, no air bubbles, no accumulated glue anywhere, etc.)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Wait for 20 minutes to let the adhesives settle for a bit.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Peel the liners apart.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Place a cutout of the EVA membrane onto the liner. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c64 c24 "><span class="c1 ">Let it dry.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 c13 c34 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Results from the adhesive tests:</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_107-1 start " start="1 ">
| + | |
| − | <li class="c6 c57 "><span class="c1 ">Rolling pin test: Opposite to what was expected, the adhesives were unevenly distributed. Air bubbles and bumps of glue were present. Some had not completely dried up, forming webs when peeled, some had.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c57 "><span class="c1 ">Film application test: The adhesives were unevenly distributed.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c57 "><span class="c1 ">Two - release - liner - sandwiched - together test: The adhesives were unevenly distributed, but this method was the most effective one. See pic below!</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 183.36px; height: 157.04px; "><img alt="https://lh6.googleusercontent.com/G1VGXsTZXwAzp2nytJ6fnDk7Mo8_dgi8mGyouQ_JWw6ABOBdlBOglKMJJ9j_D1g7lOnC6I_1WUFYWdx18F5Uaezw29ki4KDteUGihihwT8qZeE3WVdpTZSlqLlqcoJCWmiPKabre " src="https://static.igem.org/mediawiki/2016/0/0f/T--UofC_Calgary--image31.png " style="width: 183.36px; height: 157.04px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_110-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany also picked up the 3D printed models of our prototype from the machine shop </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 c56 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 174.68px; height: 174.68px; "><img alt="https://lh3.googleusercontent.com/Q6b-_3BxoTsmSJmaP0SfYbrbsnya6jmdGHCPQ37j7_P-rUjWzqHqTNrX3ttUboYEK8_ix3uFh94NshqsB20i_vxDMzTpOzwesveI4ZDZTykjT8xgh-vhwhANgUCg5_nim7Nh3fui " src="https://static.igem.org/mediawiki/2016/d/d8/T--UofC_Calgary--image32.png " style="width: 174.68px; height: 174.68px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, August 4th</span></h3>
| + | |
| − | <p class="c6 "><span class="c1 ">Team had a meeting with Dr. Nygren </span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_111-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Updates</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">3D printing</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Patch seemed to be a reasonable size according to Dr. Nygren</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Diffusion assays</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">There were bacteria leakage that happened</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Back up plans, solving issues</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Meeting with Dr. UT</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Thermoforming</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Prototyping</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Maybe we could use wax paper or parchment paper. See what happens.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Machine shop may not be able to help us since they will be closing soon for renovations. They would require us to send the SolidWorks model asap. They can’t do heat sealing for us, but they can make the mould.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">For the mould: instead of making 18 patches at a time, make it simple by making 1 at a time. Easier to manufacture, cheaper</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Adhesive: use of heat</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Manufacturing</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Materials for moulding</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Suggestions he could give us</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Moulding design he could provide</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 ">One at a time</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Contacts for manufacturing</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Companies: nope</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Professors: nope</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Modelling</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Diffusion model Noshin prepared</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">MATLAB code</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">ODE45 will help us get numerical values instead of having a function as a solution</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">C</span><span class="c67 c3 c13 c51 ">2</span><span class="c1 "> degradation</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Flux = moles/(m</span><span class="c3 c89 c13 c51 c68 ">2</span><span class="c1 ">. s); production rate = moles/s</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Start with assumed values for production rate and then move forward.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Diffusion model Nelly prepared</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_111-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Will send the document to Dr. Nygren for checking </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c3 c17 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, August 5th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_113-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Mason completed a SolidWorks model of a previous microneedle prototype design </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Noshin and David continued to manufacture patches in the lab. Following Nelly’s procedure, the made patches that were 1 cm x 1 cm</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 267.00px; height: 141.00px; "><img alt="https://lh5.googleusercontent.com/pfSoAS8wjfrF0sJF45faWbnPhemBGoxjt-oDBU5lyEd-DWZIPIpJ3T-JXC14ulvLhQjNIWKWU4OSf0Zj1NnYLGd8x--a8u5NBmnhj4GAq1GtO9DXrX8KzknhtyEXOlZAUfkIP-WO " src="https://static.igem.org/mediawiki/2016/2/2a/T--UofC_Calgary--image33.png " style="width: 317.93px; height: 190.73px; margin-left: -35.00px; margin-top: -24.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 154.84px; height: 136.20px; "><img alt="https://lh4.googleusercontent.com/REFz4eSdLc4kGa7rF-jSkvRmy655Lw7n9_fSH6lJoawV3EuvVj2oPCpiHRPC4V9BrYu9kjt4Vsb4njnq4L0VbpTYSUw6hEOyS7wsN9y-1VyKd5fxUqdLq9NaS-sl8ppyUowZQt2I " src="https://static.igem.org/mediawiki/2016/4/48/T--UofC_Calgary--image34.png " style="width: 359.27px; height: 273.45px; margin-left: -110.39px; margin-top: -67.39px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c7 c3 "> </span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, August 8th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_114-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany and Christine planned the week to perform the backing layer growth curves. These growth curves will be used to determine if cell growth is affected when gas exchange is limited</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_114-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">The Plan</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_114-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Tuesday start the overnight cultures for the growth curves in the falcon tubes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Wednesday at 4:00 pm, 12:00 and Thursday at 8:00 am start inoculation for the tubes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Thursday start overnight cultures for the growth curves in the patch and perform growth curves for falcon tubes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Perform growth curves in the patch</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_114-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Before starting the growth curves in the patch, soak the 3D printed models in 70% ethanol overnight</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c99 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, August 9th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_115-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany started the overnight cultures for the growth curves in the falcon tubes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly and David made patch prototypes today. The procedures are as follows:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Materials:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_116-0 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Strips of release liner ( 5cm x 13.2 cm )</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Strips of EVA membrane ( 5cm x 13.2 cm )</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Square cut outs of backing layer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">BIO PSA adhesive</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Cylindrical metal bar</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Masking tape</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Scissors, marker, ruler</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Flat plastic surface </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Iron </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Syringe + needle</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">Procedures:</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_117-0 start " start="1 ">
| + | |
| − | <li class="c6 c57 "><span class="c1 c46 ">Preparation of the adhesive layer</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <ol class="c2 lst-kix_list_118-0 start " start="1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Have the materials ready. Perform the process under the fume hood as the adhesives contain heptane. Heptane is flammable and create vapor trails that may cause fire.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Note that the coated side of the liner is where the adhesive will be applied. In case you cannot figure which one is the right side, grab a marker and try to write on both sides of the liner. If the ink stayed permanently on the liner, you wrote on the uncoated side. The side where the ink just slipped through would be the coated side. It would be recommended to write which side is which to avoid confusion.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Draw a horizontal line on one end of the release liners (1cm from the end) with a marker. This end will be taped to keep the liner in place when the adhesive is being applied.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Draw three 3cm x 3cm squares on the release liners. Make sure to leave ample amount of space between the squares. Draw 1cm x 1cm squares inside the initial squares. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Take all the materials under the fume hood. Tape the end release liner on the flat plastic surface. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Apply the adhesive on the line initially drawn. Apply a constant pea-size amount on the line.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Using the metal bar, spread the adhesive onto the liner. Spreading using a metal bar will form a thin film of adhesive on the liner.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Wait for about a minute before placing the EVA on the layer.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Carefully place the EVA membrane strip on the adhesive layer.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Lightly tap the membrane to stick. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Wait for the adhesive to completely dry (1 hr - 3 hrs).</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Cut out the squares.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">B. Heat sealing the patch</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_119-0 start " start="1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Set the iron to the heat sealing temperature that was previously determined.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Place the backing layer on the prepared adhesive-membrane layer.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Carefully iron the sides of the layer. Avoid ironing parts of the 1cm x 1cm square centre drawn. This is where the nutrient rich media and bacteria will be stored.</span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 "><span class="c1 c46 ">C. Adding the media in</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_120-0 start " start="1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Obtain the required amount/volume of media to be stored in the patch using a syringe.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Carefully inject the media into the middle compartments of the prepared patches by poking a hole on one of the corners of the drawn center squares.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Heat seal the holes created by the needles. </span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">***Check the whole document under </span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=https://docs.google.com/document/d/18uXLYuw3K3-0EAZaxPTyErA_iBWKPDveNloJpIzlsIU/edit&sa=D&ust=1475963638291000&usg=AFQjCNE0v6TXoKLGlofs6IqNB7Je6AVoSQ ">https://docs.google.com/document/d/18uXLYuw3K3-0EAZaxPTyErA_iBWKPDveNloJpIzlsIU/edit</a></span><span class="c16 c3 "> </span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, August 10th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_121-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The team went to the Foothills machine shop yesterday at around 2pm to consult with Peter Byrne. He was the person Dr. Nygren had referred during our last meeting. We had set the mould specifications for him to follow. He had also given us suggestions to further improve our mould. The mould will be ready for about a week. ($50 per hour of labour by the way ladies and gentlemen).</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_121-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">The mould will be made with aluminum and brass that may stick to our layers.He then recommended us to get a Teflon coating spray or something the same.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_121-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly finished adding her Powerpoint slides for the presentation on Monday. She also picked up a Dupont Non-stick Lubricant (with Teflon) from Canadian Tire.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">David and Nelly made more adhesive layers before leaving the lab. Some had thicker adhesives applied, some had thinner layers. They will see how this quality would affect adhesion or if it has any effect at all.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly tried one of the adhesive layer on her wrist. It took her a while to completely stick the layer on because it had thin adhesive coating. It also required applied pressure for it stick better. She had the layer on for 4 hours. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_121-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Result: The layer was somehow painful to remove because some of her hair were stuck on the adhesive. She said the pain felt like a degree lower than a wax sheet slowly being peeled off your skin. There was no redness or irritation that happened on her skin, but itchiness was felt when the layer was on.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Recommendations: Disinfect the skin area before patch application.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_121-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Christine continued working on the animation for Maya today and edited our presentation for August 15th.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany conducted assays in the laboratory today </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany had also tested in the lab if the 3D models would hold the initially calculated volume of media.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_121-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Results: The pockets exactly held 0.5 mL of liquid, while the content area held exactly 10 mL. Therefore, the 3D model is a good representation of our patch system in terms of holding capacity.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c11 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, August 11th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_122-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany’s focus today was to conduct the growth curve assays every 40 minutes.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Dr, Nygren</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Potential questions here → </span><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://docs.google.com/document/d/1XVAW80zyGmWSUBj1KMXs12YQdXi7uQEtbdc4q-ZRPes/edit&sa=D&ust=1475963638299000&usg=AFQjCNHCZDAio8IUePdejW_NoG-Bs0U_Og ">Questions for Dr. Nygren document</a></span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting minutes:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Update: </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Showed Dr. Nygren the full system prototype Nelly and David made</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Continuing assays by Tiffany and Christine</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Christine is working on her video</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Noshin is working on her math model</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Went to machine shop to get the thermoforming mold done</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Modelling:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Dr. Nygren said Noshin is on the right track. He will email her to clarify some details.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Prototyping:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Dr. Nygren suggested talking to Dr. Jenne about the prototype and alter it to better suit the mice.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Ask Dr. Mayi to buy the heat gun on our own</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Assays:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_122-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Try to make a connection between the assays and math models. Answer the question of why we do the assay, why we have the models, what the connections are. Cohesion is key.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, August 12th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_123-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Christine and Tiffany worked on entering data values of their growth curve assays in a spreadsheet. They created time versus absorption plots.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_123-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Results:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c22 "><span class="c1 ">Tube 1</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 380.27px; height: 240.60px; "><img alt="https://lh5.googleusercontent.com/h1dtXBI18oaz05qMdyqlZRzpa80B-MQI314SzStLNNLl4JdlN47qA3ZsiGrYS6tS2Iso4Gna9cmIDj69B8KNf4uRxSkPeH5lMbsxz101tWxSmekD9WFXqpCZ4RRaFPp6KQnuGhTA " src="https://static.igem.org/mediawiki/2016/3/3c/T--UofC_Calgary--image35.png " style="width: 380.27px; height: 240.60px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span class="c1 ">Tube 2</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 382.73px; height: 238.13px; "><img alt="https://lh3.googleusercontent.com/h3-QJBckEsZwi12oN8-fLjtVr55bvGLqTGj7LwpclwMSsnOQNP5gp5tV84nTpvdZUhcM6xhKhuEU4fPul68LzRDX5F6uqJBnLOZNSZF9se634trI24CRMvfp5hRS2Kkf1KhKrOjH " src="https://static.igem.org/mediawiki/2016/8/89/T--UofC_Calgary--image06.png " style="width: 382.73px; height: 238.13px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span class="c1 ">Tube 3</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 384.00px; height: 235.67px; "><img alt="https://lh6.googleusercontent.com/zwfydSM_a0QzBxwecouoJMSiw6_7Y6Y_OupAraqEym9t6-cZgeXsHNr13cYJKbJCg9IUvVElYawVF034gVtdU4k81rsZk2BJoNRJvOdYK0xH06UneOW9Q04zQy4E9QmqspfHElx2 " src="https://static.igem.org/mediawiki/2016/a/ab/T--UofC_Calgary--image07.png " style="width: 384.00px; height: 235.67px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span class="c1 ">Average of Tube 1, 2 & 3</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 362.80px; height: 238.13px; "><img alt="https://lh4.googleusercontent.com/OB6hmeVcwG3v3YRqYT0un1gru7kET84YX1GrfYVWwHDyptqxwNs_oreDOeiCFBM_fnho4ZaHUgi__tpL1FP3BuexTMHLUA3aJJgPWQ1mbSvEf4lBUj1zdiSfnxTwtnIUDNpMSBlM " src="https://static.igem.org/mediawiki/2016/9/92/T--UofC_Calgary--image08.png " style="width: 362.80px; height: 238.13px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c96 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, August 15th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_124-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Presentation day! What we basically did for today was preparing for our presentation and did run throughs.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">After the presentation: dead. There were challenging questions thrown at us. This means we still have things to be solidified before we can say we’re done.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">We also asked our mentors for comments with regards to our presentation. They are as follows:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_124-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Instead of having a slide with all equations on them, why not just use words that tells our audience what the terms represent.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Maya animation. Changes to be made could be:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_124-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Making the adhesive liner take up the whole bottom area of the patch.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">We’re not using the indicator system to signal low media, but tells if the bacteria is activated.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">After we have shown how the patch works, we can also extend the story by, say, an astronaut peels off the liner and apply patch, then wears this for this how many hours, and then through our modelling results we’ll figure how long before we pop a packet and then what would happen next and, you know, the story goes on yadi yadi yada.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_124-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Our graphs must be able to speak for themselves, meaning that by the time we look at them, we know right away what it is trying to tell us.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Explain all the terms that we are talking about.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">CONNECT ALL THINGS TOGETHER.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Use constants that are from the other teams. The values we get from our model runs must correlate to the models and numbers Chassis and Biotarget get. Both Rai and Dr. Nygren brought this up.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Our model should also have a flow.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c11 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, August 19th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_130-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">David and Nelly made more adhesive laminates, preparing for more prototypes</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c56 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, August 23rd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_131-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany continued doing her diffusion assays. The dialysis membranes came today as well and treated for testing. There were two types of tubing membranes that were used: 20 kD and 628 kD pore size membranes. However, these membranes are not heat sealable which would be a problem in manufacturing. There were other limitations that were mentioned and these can be found in the email Nilesh sent/cc’d us in. Tiffany will be performing diffusion assays for these membranes tomorrow.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_131-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Must be soaked in room temperature distilled water for 30 minutes instead of being boiled</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">“Just soak them- once you have figured out how to glue them together” -- Dr. Volgo</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_131-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly made around 80 adhesive laminates.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c22 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, August 24th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_132-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany performed her diffusion assays experiment using the dialysis tubing membranes.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Noshin worked on modelling and sent the codes to Dr. Nygren for checking. </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_132-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">She also asked Dr. Nygren if he could give us a contact who could help us with cost analysis for our patch.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c22 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, August 26th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_134-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Tiffany and Christine picked up the moulds from the Foothills machine shop.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The results from dialysis membrane diffusion assays came out. There is still diffusion of bacteria through the membrane. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c8 "><span class="c16 c3 c13 ">The team also met with a PhD scholar, Xiaoan Li, whose research project focuses on water filtration using nanoporous membranes. Robert, a student who works in Li’s lab, is also in the meeting.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c61 c18 c14 c65 "><span class="c3 c13 "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c3 c59 c63 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Changing points in our Project</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, May 30</span><span class="c3 c68 ">th</span></h3>
| + | |
| − | <h3 class="c4 "><span class="c16 c3 c13 ">Meeting with Dr. Dalton:</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_32-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contact 3M for hollow microneedles, look at patents </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">If he can find his microneedles he will give it to us </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Would have to consider shear stress, what if microneedles break off and go into the body</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Utah array - solid microneedle </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Lab on a chip - chips and tips </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Perhaps make microneedle system separate with valve </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Issues:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_32-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">In microfluidic systems are bubbles - bubble will block channels</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">LB chamber, what’s stopping the fluid from flowing directly out the microneedles? Perhaps use a mechanical system to control pressure, could also suck the media back in </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Diffusion would be way too slow or not even occur, would need an external syringe pump </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Leaving microneedles in for too long will cause immune response from body, wound infections </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Need to determine how much pressure the membrane can take </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Consider stress on microneedles, fact that skin is very mobile </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Skin elasticity, skin varies by thickness based on ethnicity and age, also have to consider the hairs on the skin </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c11 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, June 22nd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_71-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Dr. Amir Nezhad </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_71-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">About Dr. Amir Nezhad’s Research</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_71-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 c19 ">Dr. Sanati-Nezhad' primary research interest involves BioMEMS, Microfluidics, Tissue Engineering, Micro and Nano Technology, and Lab-on-Chip. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 c19 ">His research group has focus on development of integrated bioinspired microdevices using microfluidics and tissue engineering approaches for disease modeling, biological systems modeling, and drug discovery. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 c19 ">Another research interest of his group is to develop point-of-care devices for testing infectious diseases, and portable tools for detection of plant and food pathogens.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_71-1 ">
| + | |
| − | <li class="c0 "><span class="c1 c19 ">On meeting with him, we were invited to his lab where he showed us the process of micro fabricating the labs on the chips and how he uses microfluidics in order to do so</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 c19 ">The fabrication process is difficult. It requires a semi permeable membrane in the middle where the individual cells can be housed.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 c19 ">Surrounding the permeable membrane is silicone mold to provide structure and handling.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 c19 ">Although the chip looks simple, actual analysis requires a system of micropumps to transfer media, waste and byproducts across the system. This in turn is connected to a computer or microscope system for analysis.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 " id="h.gjdgxs "><span class="c1 c19 ">In order to work for cells for 30 days, the first 6 - 15 days is incubating the cells and ensuring they are in a happy media. After that, you can start researching on the cells</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 c19 ">He mentioned the importance of finding the optimal flow rate in the chip because anything above or below they flow, will disrupt the cells and kill them</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 c19 ">In concerns with our project</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_71-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 c19 ">He thinks the general idea of a patch system releasing various peptides into the body is very interesting and sees potential for collaboration with his lab</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 c19 ">When asked about companies to order from he suggested Dow Corning</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 c19 ">He stressed the importance of drafting up a prototype of our design in AutoCAD so he could better understand what our design will look like (not really? We asked him what he used for visual modelling and he said AutoCAD. However, he did stress making a powerpoint presentation to show people we consult to give them a better idea of what we are doing)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_72-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 c19 ">Gave us access from his lab to purchase AutoCAD</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_72-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 c19 ">When asked about fabrication, he volunteered his services or that of the mechanical shop to create a prototype</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, June 23</span><span class="c3 c68 ">rd</span></h3>
| + | |
| − | <p class="c18 "><span class="c3 ">Meeting with Dan and Dr. Mayi</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_73-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contacted Porex for EVA samples - waiting for response</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Also discussed with Dan about assays we can perform for both the semi permeable membrane and backing layer</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_73-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">For the semi permeable membrane </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_73-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Using a 15 mL falcon tube, we can fill it with overnight cultures and wrap the semi permeable membrane underneath the lid. We then invert it in a larger 50 mL falcon tube with water, salts and at the same pH as the blood and leave it to sit. After hourly intervals, we would take samples of the water and take the OD readings.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Another assay that we can do is to use a brute force method and apply the same </span><span class="c16 c3 ">setup</span><span class="c1 "> as the first assay. However we would centrifuge it down and see at the extremes how well our semi permeable membrane works.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_73-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">For the backing layer</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_73-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Dr. Mayi suggested creating a small patch with overnight cultures and leave it to sit in conditions similar to those found in the ISS. We take an OD reading initially and then let it sit for eight hours before taking another reading at the end and comparing the growth of our cells. We can also measure the amount of moisture vapour by measuring before and after the mass of the patch.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c47 "><span class="c3 c13 ">Dan also suggested something similar to measure how well our cells grow. Using the small plates, we would aliquot some of our overnight cultures into two plates. We would then cover one with parafilm and the other with our backing layer. We then leave them to shake in the incubator. We take the initial OD and the final OD reading then of both to see how well our cells have grown</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, July 21th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_92-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">David replied to 3M, they sent me back an email with useful info. I forwarded to everyone:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_92-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Temperature and pressure depends on system: </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_92-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">250F and 40 psi for their small single well sealer - 1 second so the liner doesn’t warp.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">However, multiple well sealer needs 300F, 50 psi</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">=> May need a few trials to decide the parameters</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_92-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">They can create a crude prototype to give us some idea of usability</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">If making it ourselves, they recommend a sequence of steps:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_92-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">coat adhesive onto the liner, laminate the membrane to the liner through a low pressure nip roller and lastly heat seal the backing to the lamination (on the membrane side) by placing the materials to be sealed onto a well type receiving fixture with silicone sealing gaskets and using a platen type seal plate above.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_93-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Our membranes are the most permeable. The main difference is the thickness between the 2. The thicker one (9716) will have a slower transmission rate. If nothing works, they’ll help us pick out another one.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 c22 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_94-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Dr. UT Sundararaj about manufacturing:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_94-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">He went over the project with us and said gel media might be safer when being punctured but diffusion might be compromised. However, he said at equilibrium everything should be the same.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">He approved our materials for the patch. He told us to consider the materials’ solubility parameters to make sure they are compatible and nothing will dissolve into each other when heated. EVA and polyethylene are fine. We might want to check hexane/heptane in the silicone adhesive and EVA though, but it should be fine.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_94-2 start ">
| + | |
| − | <li class="c5 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://cool.conservation-us.org/byauth/burke/solpar/solpar2.html&sa=D&ust=1475963638348000&usg=AFQjCNHfrehsKHdAN0cfEj53xRqT93nXUA ">http://cool.conservation-us.org/byauth/burke/solpar/solpar2.html</a></span><span class="c1 "> If delta is >+-2 it should be okay.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_94-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">He recommended using thermoforming for our mouse patches. The general idea is to make a wood “mold”, heat our backing layer up, put it on, vacuum so it forms a reservoir, pour the media in, put the membrane on top, and then heat seal everything together. A flat iron for hair or something might work. It’s also a good idea to apply heat on both sides.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_94-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Thus, we need to get in touch with the machine shop ASAP</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c101 "><span class="c54 c3 "><a class="c28 " href="https://www.google.com/url?q=http://www.plasticsmag.com/thermoforming.asp?fIssue%3DMar/Apr-03&sa=D&ust=1475963638350000&usg=AFQjCNF_gxbO8Kj9gd8T0UgOgMM1SgLJfA ">http://www.plasticsmag.com/thermoforming.asp?fIssue=Mar/Apr-03</a></span><span class="c3 c13 "> some reference we pulled out from google today about thermoforming.</span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, July 22nd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_95-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Dow Corning (finally!) responded to Nelly about the preparation of adhesives.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_95-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Basically, the actual adhesives are dissolved in heptane. This is the reason why handling it without precaution might cause irritation. The adhesive in its pure form is safe to use. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Easy enough, we just have to let the heptane evaporate so we can use the adhesives. The evaporation rate will depend on the temperature of the environment. In some patent documents she found online, companies dried the same type of adhesive in 100</span><span class="c3 c13 c51 c68 c89 ">o </span><span class="c1 ">C oven for 2-3 minutes.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c21 "><span class="c3 c13 ">Note, we must do any adhesive assays under the fume hood.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, August 17th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_125-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Dr. Jenne (August 17, 2016)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Mouse orders done on W</span><span class="c1 ">ed the 24th potentially</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Might take some time to do training, he’s concerned about the timeline since he technically can’t order mice until he got ethics done</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">He thinks that the biggest thing for us is mass spectrometry</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Problems we might encounter:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_125-1 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Peptide not being found in the blood</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">If it's found in the blood, what if it’s absorbed by other cells or organs</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_125-0 ">
| + | |
| − | <li class="c0 "><span class="c1 ">The most important thing is what we get out of it, what the results tell us, and our future solutions for it. It’s okay if it fails.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c27 "><span class="c16 c3 c13 ">We have to change the dimensions of our patch to make it narrower and longer.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, August 22nd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_128-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Modelling meeting with Dan</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">In our modelling story, this experiment would be in the beginning of the story. This would be use which peptide we are going to use. Once our peptide has gone into the bloodstream, this model would help us determine how fast our peptides would diffuse through the cells to do its functions.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Different forms of our peptide</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">How it would go through our membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Looking at the energy levels</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Applying force to membrane through a bilayer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Very hydrophobic = low energy in the middle</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Calculate energy</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Size of the system</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Peptides: we want to model the different forms of our peptide and see which diffuse the fastest</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">9-residue monomer - linear (reduced form) and cyclic (oxidized form, ring, forming a disulfide bond = might affect diffusion, should it be reduced or not)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">TD1 tag: compare that to BBI (combination of the 2 may have a better effect)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">KSCI + monomer + F at the end</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Having a negative control </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Like a sodium ion (+ve)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Hormone that readily diffuses through</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Another important part: bilayer</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Simulate the actual membrane</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 ">One type of human bilayer = have a smoother curve</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Or a hydrocarbon bilayer/disc</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Talk to them if we could have a simple bilayer with true phospholipid</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Explicit water on the outside</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">Size of the environment (10nm cube, etc.)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_128-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Ask if there is data already existing </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, August 26th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_135-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The team also met with a PhD scholar, Xiaoan Li, whose research project focuses on water filtration using nanoporous membranes. Robert, a student who works in Li’s lab, is also in the meeting. He was a previous member of the winning iGEM team in 201_. Here’s what we talked about:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Ask Dr. Mayi or Deirdre about other membranes that we could test</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">Examples </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 ">centricon: small scale version, 5kD (ask Goodarzi’s godmother): not as big, small scale purification, good for centrifuge works</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">filter sterilization membranes (0.22 micron)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">Watch 2011 NASA - video</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">figure out what carbon nanotubes we need, they got some. They have PPL, carbon nanotubes. Once we’ve tried everything and still fail, then we should ask them.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Other ideas</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">dissolving O</span><span class="c3 c13 c51 c67 ">2 </span><span class="c1 ">on the actual membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">We need less than 200 nm of pore sizes</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">SEM, AFM: contact Matthias Amrein - does lung cells; Michael (runs SEM)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-3 start ">
| + | |
| − | <li class="c6 c40 "><span class="c1 ">use something conductive, Teflon is not conductive</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c40 "><span class="c1 ">thin sheet of gold</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_135-2 ">
| + | |
| − | <li class="c5 "><span class="c1 ">figure out what materials we would need at the moment</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c27 c18 c14 "><span class="c3 c13 "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Providers</span></h1>
| + | |
| − | <h3 class="c4 " id="h.fdtmd7bfhu82 "><span class="c3 ">Companies involved:</span></h3>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h4 class="c4 c31 " id="h.usxiqarmf0b2 "><span class="c3 ">3M</span></h4>
| + | |
| − | <ul class="c2 lst-kix_lvjn8glkfwf0-0 start ">
| + | |
| − | <li class="c18 c8 c31 "><span class="c16 c3 ">Provided us with all the sample materials used in the team’s assays</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c8 c31 "><span class="c16 c3 ">The following materials are as follows:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_lvjn8glkfwf0-1 start ">
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">3M CoTran™ 9722 Backing Polyethylene Monolayer Film</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">3M CoTran™ 9719 Backing Polyethylene Monolayer Film</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 "> 3M CoTran™ 9716 Ethylene Vinyl Acetate Membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">3M CoTran™ 9728 Ethylene Vinyl Acetate Membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">3M Scotchpak™ 1022 Release Liner Fluoropolymer Coated Polyester Film</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 c31 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h4 class="c4 c31 " id="h.ya27dyoiffqu "><span class="c3 ">Dow Corning</span></h4>
| + | |
| − | <ul class="c2 lst-kix_fahi2s4j7zmm-0 start ">
| + | |
| − | <li class="c18 c8 c31 "><span class="c16 c3 ">Provides us with the adhesive samples used in our patches. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c8 c31 "><span class="c16 c3 ">The following materials are as follows:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_fahi2s4j7zmm-1 start ">
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">Dow Corning BIO-PSA Silicone-based Adhesive 7-4101</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">Dow Corning BIO-PSA Silicone-based Adhesive 7-4201</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c21 c31 "><span class="c16 c3 ">Dow Corning BIO-PSA Silicone-based Adhesive 7-4301</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 c31 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 c31 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 c84 "><span class="c3 "></span></h1>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <h1 class="c4 c84 "><span class="c3 "></span></h1>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Collaborations</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Thursday, July 7th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_list_80-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The team continued working on the diffusion model by either researching the equations further to see if there is another perspective we can take on the model or writing a code that can be used in MATLAB</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Nelly was able to get a graph of the result of her MATLAB code [Insert image or comments here about the result Nelly!]</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Meeting with Waterloo</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_80-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">The modelling team met with the UWaterloo Modelling leads to discuss a possibility for collaboration</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">They are working on a project that uses yeast to take advantage of the higher readthrough rates during prion response</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">There is not very much commonality between the two projects but one potential would be a collaboration on their protein aggregation model as it would involve transcription rates</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">However after discussing, it may not be worth the collaboration between us and Waterloo</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h4 class="c4 "><span class="c3 ">iGEM Collaboration UCalgary & UWaterloo MM</span></h4>
| + | |
| − | <p class="c18 "><span class="c3 ">07 JULY 2016 / 4:00 PM</span>
| + | |
| − | </p>
| + | |
| − | <p class="c33 c18 "><span class="c3 c34 ">ATTENDEES</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_81-0 start ">
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">Zoë Humphries, Emily Watson, Tiffany Dang, Nelly Mendoza, David Nguyen, Sid Goutam and Nilesh Sharma</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c3 c34 ">BRIEF INTRO</span>
| + | |
| − | </p>
| + | |
| − | <p class="c33 c18 "><span class="c46 c3 ">UWaterloo Project Summary</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_81-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Creating a system that takes advantage of higher readthrough rates during [PSI+] state of prion response </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Model of iGEM collaboration network from 2015</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Model of plasmid retention - metabolic load of expressing our fusion protein</span>
| + | |
| − | </li>
| + | |
| − | <li class="c33 c18 c8 c44 "><span class="c10 c3 ">Model of protein aggregation - how the prions are distributed through generations</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c33 "><span class="c46 c3 ">UCalgary Project Summary</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_82-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Working a transdermal delivery system to deliver peptides to the body</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Specifically working on the delivery of the Bowman Birk Inhibitor which as shown radioprotective effects </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Modelling the diffusion of BBI into the body to determine the initial concentration needed to be produced</span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">Model of the required transcription rates to produce the required amount of BBI or what a reasonable amount of BBI can be expected</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c46 c3 ">MORE DETAIL ABOUT WATERLOO MODEL</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_83-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Gene Retention Model</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c3 c10 ">Determine number of copies based on fluorescent protein in plasmids</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Retention is dependent on metabolic load, stability of plasmid, </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Quantify using fluorimetry</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Protein Aggregation Model</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Model how long it takes for aggregation to form (help lab subteam)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">No differential equations as of yet</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Probabilistics important for chance of inheritance in daughter cells</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Quantify aggregation via Western blots</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">System should break down prions, will model this disassembly</span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">Quantify breakdown via GFP (sup35 prion protein begins functioning again)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c46 c3 ">MORE DETAIL ABOUT CALGARY MODEL</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_84-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Diffusion Model </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Model how long it takes for the diffusion of BBI to reach steady state</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Compartmentalized the diffusion system into three components: the patch to the skin to the blood stream</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">No differentials equations at this point but trying to use Fick’s Law in MATLAB to see if we can analytically solve for the steady state</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Also using this model to determine the initial concentration needed in the patch for the desired amount of BBI to be found in the blood stream</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Transcription Rate Model </span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">Model to determine how fast the peptides are being produced inside the patch and how varying transcription rates will create the necessary concentration of peptide needed in the patch</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c46 c3 ">ACTUAL ITEMS FOR COLLABORATION</span>
| + | |
| − | </p>
| + | |
| − | <p class="c33 c18 "><span class="c3 ">UCalgary Assistance</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_85-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Help starting with the transcription rate models to determine how fast the peptides are being produced and what is a reasonable initial concentration based on these rates</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Mentoring for the diffusion model. This would be in the form of bouncing questions with Waterloo to see if we are on the right track and if there are any considerations we need to take</span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">With the gene retention model, UCalgary can help by collaborating on the transcription rates specifically</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c3 ">UWaterloo Assistance </span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_86-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Gene retention subgroup most likely to benefit from assistance</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Optimising expression of plasmid number over gene copy number in plasmid</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Modelling expression of gene, how quickly the plasmid is lost during normal and prion states ([PSI+] condition)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Dr. Brian Ingalls works on gene retention in bacteria, is a great resource</span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c33 c18 c8 "><span class="c10 c3 ">Transcription rates would benefit gene retention and protein aggregation</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c33 c18 "><span class="c3 ">ACTION ITEMS</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_87-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c10 c3 ">Use Google Drive to maintain collaboration docs</span>
| + | |
| − | </li>
| + | |
| − | <li class="c44 c18 c8 c81 "><span class="c10 c3 ">UWaterloo will send update e-mail to math subteam & CC UCalgary</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 c34 c17 c43 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c14 c18 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c63 c3 c59 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Manufacturing</span></h1>
| + | |
| − | <h3 class="c4 " id="h.oqjli87ma178 "><span>Wednesday, August 24th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_835ax5k7z1l9-0 start ">
| + | |
| − | <li class="c18 c8 c31 c53 c48 "><span class="c16 c3 ">Dave and Nel worked on manufacturing today. David had figure out a way to properly make our mice testing patches. The protocol is as follows:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c31 c53 c48 "><span class="c16 c3 c34 "> Procedure:</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_g5lskmm1i0dj-0 start " start="1 ">
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Prepare the adhesive laminates following Nelly’s procedure</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Plug the iron in to preheat.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c18 c20 "><span class="c16 c3 ">Look through the adhesive laminate under a light source and pick out and most even area. Sketch the 1 x 1 cm square on the liner at the center of the area</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Trim the laminate to roughly 1.5 x 1.5 cm</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Lay the laminate membrane-side up on the iron board, and the backing layer on top</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Iron 1 side of the patch up to the sketch. To make the seal even and bubble free, when sealing, apply more pressure on the side of the iron that’s touching the line, then tilt the iron so that side of the iron lifts up slightly, then press it down again, after each time, move the iron away from the line to the edge of the patch. The seal should look clearer than the center. If not, then the iron is not hot enough, redo using a different side of the iron until it’s clear</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Seal the other 3 edges. Now the patch should be stuck to the iron board, leave it there. Repeat the process for another 2 patches.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Remove the first patch from the iron board. Prevent peeling the patch off the liner by sliding a finger under the patch after you peel off 1 corner when you reach the liner.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Hold the patch diagonally, vertically, backing-side facing you. Bend it slightly so the backing folds towards you. The backing at the center (not sealed) should bend and separate from the membrane, creating a thin pocket running diagonally from the top corner to the bottom corner.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Fill the syringe with water, use the needle to poke a hole at the top corner of the patch, make sure the needle did not poke anywhere else and the needle is in deeper than half of the patch.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Inject the water slowly, keep a bend in the patch so we have a pocket, fill it from the bottom corner, tilt the needle and the patch to get the other 2 corners, then fill it nearly to the top corner. A good volume should be 0.06 - 0.08 mL</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Remove the needle straight out, a drop of water may leak out, dry it lightly with paper towel, don’t push on it</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Lay it on the iron board. Make sure there’s no water droplet visible. If there is, dry it gently with a paper towel, then iron on the hole for about 1-2 seconds</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Press on the patch slightly to see if there’s still any leaks, if yes, dry the droplet of water with paper towel and re-iron the corner until there’s no more leaks.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Now the patch is done, trim the sealed sides with scissors to approximately half of the original side dimensions. Round off the sharp corners</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">Cut a bandage in half, horizontally, then cut it vertically to create 2 small rectangles, with the sides approximately to be twice of the sealed sides of the patch </span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">To put the patch on a finger, remove the liner, put it on and press all edges lightly but firmly until all edges stay down</span>
| + | |
| − | </li>
| + | |
| − | <li class="c20 c18 "><span class="c16 c3 ">To reinforce the patch, put the 2 bandage pieces on both sides that go down to the sides of the finger </span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c18 c31 c53 c48 "><span class="c16 c3 c34 ">*Note:</span><span class="c16 c3 "> A patch with “YES” written on it is on the iron board. It should show you the size of the patch, how clear the seals get, and how I seal the hole. You can ask Tiffany about the process of applying since she had 5 on her fingers today.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c31 c48 c53 "><span class="c16 c3 c34 ">*Note 2: </span><span class="c16 c3 ">This is a pretty reliable method. The seal works great most of the time. Poking more than 1 hole in the patch happens once in awhile. The patch stays on well most of the time. The water will leak when you put on if the seal is not good enough, or if there’s another hole you accidentally poked.</span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 c75 " id="h.63wtgmetxp6p "><span></span></h3>
| + | |
| − | <h3 class="c4 " id="h.h3fuz11zfuth "><span>Wednesday, August 31st</span></h3>
| + | |
| − | <ul class="c2 lst-kix_1qgee6j7obt0-0 start ">
| + | |
| − | <li class="c18 c8 c31 c53 c48 "><span class="c16 c3 ">David made some more mice patches for Thursday</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 " id="h.n0v42itdw701 "><span>Thursday, September 1st</span></h3>
| + | |
| − | <ul class="c2 lst-kix_61pipssxjd5z-0 start ">
| + | |
| − | <li class="c18 c8 c31 c53 c48 "><span class="c16 c3 ">David put 3 patches of different shapes (square, rectangle, and triangle) on the mice in Dr. Jenne’s lab and reinforced them with tissue glue.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c39 c31 c48 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 331.37px; height: 441.50px; "><img alt="14194423_1450990628247663_622812832_n (2).jpg " src="https://static.igem.org/mediawiki/2016/a/a3/T--UofC_Calgary--image01.png " style="width: 331.37px; height: 441.50px; margin-left: 0.00px; margin-top: 0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 " id="h.5doz1h9godgl "><span>Friday, September 2nd</span></h3>
| + | |
| − | <ul class="c2 lst-kix_6ppt4s25kk1y-0 start ">
| + | |
| − | <li class="c18 c8 c31 c53 c48 "><span class="c16 c3 ">All 3 patches from yesterday survived. The rectangle and triangle worked better than the square. Rachelle from Dr. Jenne’s lab said the rectangle looked best.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 " id="h.81lmk4oa5bpt "><span>Tuesday, September 5th</span></h3>
| + | |
| − | <ul class="c2 lst-kix_ee0fx9z4yp3a-0 start ">
| + | |
| − | <li class="c18 c8 "><span class="c16 c3 ">David created 28 patches for the mouse testing with 9 containing water, 9 containing bacteria and 10 containing pure BBI </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c39 "><span class="c16 c3 "> </span>
| + | |
| − | <hr style="page-break-before:always;display:none; "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 326.50px; height: 433.66px; "><img alt="14256280_1456885567658169_317594022_n (2).jpg " src="https://static.igem.org/mediawiki/2016/d/da/T--UofC_Calgary--image00.png " style="width: 326.50px; height: 433.66px; margin-left: 0.00px; margin-top: 0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Research</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Papers:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.ncbi.nlm.nih.gov/pubmed/21139238&sa=D&ust=1475963638401000&usg=AFQjCNF3sA_qnh8kv0Bvc27yfDcDrjwXpA ">http://www.ncbi.nlm.nih.gov/pubmed/21139238</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_2-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Hydrophilic large molecular compounds</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Via hollow microneedles </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_2-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Loaded into lower epidermis and superficial dermis</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_2-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Release rates (Fick’s Law of Diffusion)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_2-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Increase volume of FD-4 injected - faster the FD-4 release rate from skin</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Release rate increases when FD-4 given in multiple injections</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Large molecule = lower release rate from skin</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_2-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Silicon - useful material? </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Questions:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_2-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">So is the drug being released secreted out of the skin after secretion?</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.ncbi.nlm.nih.gov/pubmed/22575858&sa=D&ust=1475963638405000&usg=AFQjCNFte3ZAimcCVyzbAljVlvZ2pXePSQ ">http://www.ncbi.nlm.nih.gov/pubmed/22575858</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_3-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Sections 2.4, 3.1,2</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Pressure gradient - greater pressure causes drug to flow through </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Diffusion gradient </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Questions:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Based on methods of delivery - silicon; have to test and make sure peptide/fluid/bacteria doesn’t react with silicon</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Simulate a large scale prototype of design to test if we can use pressure/diffusion to get the peptide to flow through</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Problem:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">For microneedles that use multiple needles (our suggested form):</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-2 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">1 microneedle leaks</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Pressure can’t be equally applied to all needles </span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 ">Fluid won’t flow through all microneedles equally</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">The small size of microneedles - drugs given on/within microneedles limited to microgram dose </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Applications of microneedles </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Biotherapeutics, drugs (peptides, proteins, DNA,RNA)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Hollow microneedles - used for insulin delivery in both rats and humans</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Diffusion and active infusion worked, decreased blood-glucose levels after injection </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Humans found it to be:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_3-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Decreased pain</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">More preferred (compared to normal needles)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Increased insulin pharma</span><span class="c16 c3 ">c</span><span class="c1 ">okinetics almost 2-fold - may cause better control over post plasma glucose levels </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Had faster insulin absorption and enabled more rapid onset and offset metabolic effect on blood glucose levels than injection </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://www.researchgate.net/publication/228562173_Side-Opening_Hollow_Microneedles_for_Transdermal_Drug_Delivery&sa=D&ust=1475963638411000&usg=AFQjCNGp-kWNEJeIoq0QKQgXtWAOm2PLdQ ">https://www.researchgate.net/publication/228562173_Side-Opening_Hollow_Microneedles_for_Transdermal_Drug_Delivery</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_4-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Proposed design - measurements for diameter length of needle, etc. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">pump/syringe for injection</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_4-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Need to test diffusion; if diffusion doesn’t work, use hand to press </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_4-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Overdose problem</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_4-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">Reservoir patches give tighter control of delivery rates but can have an initial burst of drug release. If the membrane is damaged, there is also a risk of sudden release of drug into the skin and overdose as potentially a larger area of skin is exposed for drug absorption.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">In a matrix patch, the active ingredient is distributed evenly throughout the patch. One-half of a patch will have half the original surface area and deliver half the original dose per hour. The matrix patch carries less risk of accidental overdose and offers less potential for abuse than the reservoir system.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c30 c16 c3 c19 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 c19 c55 "><a class="c28 " href="https://www.google.com/url?q=http://ieeexplore.ieee.org/stamp/stamp.jsp?tp%3D%26arnumber%3D659727&sa=D&ust=1475963638414000&usg=AFQjCNHQ1sSB0qgvE3-lsKNeOJ2AAV-7gg ">http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=659727</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_30-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">The principle of operation is based on the pressure barrier that develops when cross section of capillaries change abruptly in neck and expansion regions. This type of gating device in its normal state can only stop flow, but it can be electrically triggered to re-establish flow when used in combination with two electrodes.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c30 c16 c3 c19 ">Mechanics: The capillary stop consists of a region of the tube that is necked down followed by a sharp enlargement. When the liquid as first introduce in the reservoir, it wicks in the necked region and abruptly stops at the neck of the outer edge preventing any outer flow. The pressure barrier provided by the stop can be overcome by external pressure to re-establish a flow.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c3 c59 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Material Research</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Tuesday, May 31st</span></h3>
| + | |
| − | <p class="c12 "><span class="c54 c3 "><a class="c28 " href="https://www.google.com/url?q=http://images.alfresco.advanstar.com/alfresco_images/pharma/2014/08/22/ba2e9668-a586-4daf-9179-70f220be6e56/article-18600.pdf&sa=D&ust=1475963638419000&usg=AFQjCNGuYctNi8FpAmtyY7Jf23x1Uk7RgA ">http://images.alfresco.advanstar.com/alfresco_images/pharma/2014/08/22/ba2e9668-a586-4daf-9179-70f220be6e56/article-18600.pdf</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c3 c13 c34 ">PSA = Pressure Sensitive Adhesives</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_33-0 start ">
| + | |
| − | <li class="c8 c12 "><span class="c3 c13 ">Materials that adhere to skin with application of light pressure and do not leave residue upon removal</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">See paper for materials used</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_33-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">Acrylic-, polyisobutylene- & silicone based adhesives commonly used in transdermal patches </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_33-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Increasing the polymer content provides a softer and tackier adhesive, whereas higher resin levels result in lower tack but higher adhesion and resistance to cold flow.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Release liner is peeled off = also has the adhesive properties</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 "><span class="c3 c13 c34 ">Idea to prevent water from leaking out:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_34-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Adding some sort of liquid in pores that will let peptide through and not let media mix with it</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Gel-like fluid for media</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 "><span class="c3 c13 c34 ">Design of patches:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_36-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Polymer membrane partition-controlled TDD systems</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_36-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">There is a constant release as long as concentration is maintained, but release rapidly decline when device approaches exhaustion</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c39 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 381.53px; height: 189.53px; "><img alt="https://lh5.googleusercontent.com/JCscMWwIIWCZyQmhyo_RWNyF40eYT0ch-4-EVTEAFEFeC1shib1cXuxpdL8CGpVBTrZ4_cB0vFXafs0tE2v1AeEOYY4S-t0v-z77Vf4dG_JOsxlvmhMicI0lsgwBWDmczCc6iVBt " src="https://static.igem.org/mediawiki/2016/c/c6/T--UofC_Calgary--image09.png " style="width: 381.53px; height: 189.53px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_36-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Reservoir system</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_36-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">Same concept</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_36-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Drug in adhesives</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_36-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">I don’t think this is applicable for us, but would put it here just for reference</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c39 c22 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 426.40px; height: 158.33px; "><img alt="https://lh4.googleusercontent.com/h7rTSADFOw6X9T3I3CBLc5iCg8a4Dtr9oximAGA7e0HLF11-_Bx7wPfhAYrjvE9E3NH6rJhW2pasWWxZWKU2yKe4O7JrVG7iwReQJ-kGD1Wt0A97VItuJNCRFiUuoqV25KTvCoil " src="https://static.igem.org/mediawiki/2016/4/4d/T--UofC_Calgary--image10.png " style="width: 426.40px; height: 158.33px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_39-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c13 ">Micro reservoir type</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_39-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">Suspension of drug with aqueous solution of water-soluble liquid soluble polymer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c3 c13 ">Homogenous dispersion of drug suspension in a lipophilic polymer (silicone elastomer)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c21 "><span class="c3 c13 ">Example: nitroglycerin patches</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Competitors:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_40-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">TEPI Patch </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_40-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Articles:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_40-2 start ">
| + | |
| − | <li class="c5 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://futurerxdream.com.ng/ibuprofen-patch-heralds-side-effect-free-drug-future/&sa=D&ust=1475963638426000&usg=AFQjCNHW_SR7RgiUQ7m1anF6vBw1Q_dUvQ ">http://futurerxdream.com.ng/ibuprofen-patch-heralds-side-effect-free-drug-future/</a></span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.painnewsnetwork.org/stories/2015/12/9/new-skin-patch-delivers-pain-relief-with-ibuprofen&sa=D&ust=1475963638427000&usg=AFQjCNHw69dxQlfSjMWKJ8CK2CrwqBbTng ">http://www.painnewsnetwork.org/stories/2015/12/9/new-skin-patch-delivers-pain-relief-with-ibuprofen</a></span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_40-1 ">
| + | |
| − | <li class="c0 "><span class="c1 ">24 hour medication</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Constant drug delivery for 24 hours</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">The drug is dissolved into the adhesive layer which helped it to release the drug in a steady rate and to take up more drug</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Will be used for pain medication, so this will be applied to the </span><span class="c16 c3 c13 c34 ">SPECIFIC </span><span class="c1 ">area where pain is felt</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Will be out in the market for 3 years</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, June 1st</span></h3>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Adhesive layer research:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_41-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://geckskin.umass.edu/&sa=D&ust=1475963638430000&usg=AFQjCNGjJ9trLZeXMTdeDhvIcr2E2ftvGQ ">https://geckskin.umass.edu/</a></span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_41-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Super-adhesive based on mechanics of gecko feet </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Leaves no residue </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Not sure if we can get our hands on this though… </span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Friday, June 3rd</span></h3>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.tandfonline.com/doi/pdf/10.1517/17425247.2012.637107&sa=D&ust=1475963638432000&usg=AFQjCNF5kl5NfWeX4z5yXPo05T3hZDW4bg ">http://www.tandfonline.com/doi/pdf/10.1517/17425247.2012.637107</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_42-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">PSA’s fall into three categories: solvent based, water based and hot-melt</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_42-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Solvent based are traditionally used in patch production</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_42-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">o</span><span class="c45 c3 c13 "> </span><span class="c1 ">Water based and hot-melt are more beneficial for skin irritation, sensitization and environmental contamination risks</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">o</span><span class="c45 c3 c13 "> </span><span class="c1 ">Polyisobutylenes are better for allergenicity compared to acrylics and silicone-based</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Patch failures:</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">o</span><span class="c3 c13 c45 "> </span><span class="c1 ">Case I: Adhesive failure</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">o</span><span class="c45 c3 c13 "> </span><span class="c1 ">Case II: PSA doesn’t adhere to backing layer</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c90 "><span class="c1 ">o</span><span class="c45 c3 c13 "> </span><span class="c1 ">Case III: matrix has good adhesive strength, poor cohesive strength</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c90 "><span class="c1 ">o</span><span class="c45 c3 c13 "> </span><span class="c1 ">Case IV: adhesive and cohesive failure</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 376.53px; height: 210.73px; "><img alt="https://lh6.googleusercontent.com/VAm_47mD-Nusi9DxE923OGCPLdhmls7Pi50h3QlVLzndcmqNLNr8CWACw3GfsvQ_76KJRYJl7sso9jhDhszTO5dsP3gEbRrYme2JSRFGV_4GlY48fh00QcHPvsidcthgGxuFMb_m " src="https://static.igem.org/mediawiki/2016/3/30/T--UofC_Calgary--image11.png " style="width: 376.53px; height: 210.73px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_44-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">PIB-based adhesives:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_44-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Disadvantage: easy oxidation and low air and water vapour permeability</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_44-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Acrylic-based adhesives:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_44-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Colorless and transparent</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">More resistant to oxidation</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_44-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Silicon-based adhesives</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">When testing in vivo performance:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_44-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Need to find an artificial material that is able to simulate continuous variations of skin humidity - related to critical surface tension, surface roughness and deformability</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Skin deformability is most critical to consider </span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Effects of relative adherend humidity on peel adhesion performances can be studied using collagen-coated plates</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">When peeling off a patch, need to consider tensile deformation, bending stiffness and substrate deformation</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Stress distribution on skin deformation was measured in vivo by tension, torsion, suction and indentation tests</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c13 c34 ">Some Market Research:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c13 ">Paper: </span><span class="c16 c3 c13 c34 c19 ">Challenges and opportunities in dermal/transdermal delivery</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c73 ">From <</span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2995530/&sa=D&ust=1475963638443000&usg=AFQjCNE_3zeWe9_COcMyRbpjcafixGVf2A ">http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2995530/</a></span><span class="c16 c3 c73 ">></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c13 ">PATCHES that is applicable in our subgroup:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_58-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Clonidine patches</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_45-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Catapres TTS</span><span class="c16 c3 c13 c19 ">®</span><span class="c16 c3 c13 "> was introduced in </span><span class="c16 c3 c13 c34 ">1984</span><span class="c16 c3 c13 "> for high blood pressure as the first 7-day patch system</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">"The patch should stay in place during showering, bathing, or swimming for </span><span class="c16 c3 c13 c34 ">a full 7 days</span><span class="c16 c3 c13 ">." From <</span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=http://www.mayoclinic.org/drugs-supplements/clonidine-transdermal-route/proper-use/drg-20073656&sa=D&ust=1475963638446000&usg=AFQjCNHOJ5JX-N3AMDWe17uZ1usYYznFJg ">http://www.mayoclinic.org/drugs-supplements/clonidine-transdermal-route/proper-use/drg-20073656</a></span><span class="c16 c3 c13 ">></span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Clonidine is in a class of medications called centrally acting alpha-agonist hypotensive agents. It works by decreasing your heart rate and relaxing the blood vessels so that blood can flow more easily through the body. From <</span><span class="c16 c3 c54 "><a class="c28 " href="https://www.google.com/url?q=https://www.nlm.nih.gov/medlineplus/druginfo/meds/a608049.html%23precautions&sa=D&ust=1475963638446000&usg=AFQjCNEwtevnBBYWyKX8JK1bIacE9kb9bw ">https://www.nlm.nih.gov/medlineplus/druginfo/meds/a608049.html#precautions</a></span><span class="c16 c3 c13 ">></span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">How did they solve the problem with loss of adhesion? "If the clonidine patch loosens while wearing it, apply the adhesive cover that comes with the patch. The adhesive cover will help to keep the clonidine patch on until it is time for the patch to be replaced. If the clonidine patch significantly loosens or falls off, replace it with a new one in a different area. Replace the new patch on your next scheduled patch change day."</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c22 c29 "><span class="c16 c3 c73 ">From <</span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=https://www.nlm.nih.gov/medlineplus/druginfo/meds/a608049.html%23precautions&sa=D&ust=1475963638447000&usg=AFQjCNFvVVPHQYgT5YBjBxPVFKrKGSi8tA ">https://www.nlm.nih.gov/medlineplus/druginfo/meds/a608049.html#precautions</a></span><span class="c16 c3 c73 ">></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_57-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Climara patches</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_46-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Treating conditions due to menopause (eg, hot flashes; vaginal itching, burning, or dryness), treating vulvar and vaginal atrophy, and preventing osteoporosis. It is also used for estrogen replacement therapy after failure of the ovaries and to relieve symptoms of breast cancer. </span><span class="c16 c3 c73 ">From <</span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=http://www.drugs.com/cdi/climara-weekly-patch.html&sa=D&ust=1475963638449000&usg=AFQjCNFyBxrQthQhclz_fz4lqPQPEJuA6A ">http://www.drugs.com/cdi/climara-weekly-patch.html</a></span><span class="c16 c3 c73 ">></span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Method of application: A new patch should be applied to your skin on the same day once a week (i.e., the patch should be changed once every 7 days)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c22 c29 "><span class="c16 c3 c13 ">From <</span><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=http://chealth.canoe.com/Drug/GetDrug/Climara&sa=D&ust=1475963638450000&usg=AFQjCNEvOgdgbCvS0TyM6j2-xE7Bcx2nBA ">http://chealth.canoe.com/Drug/GetDrug/Climara</a></span><span class="c16 c3 c13 ">></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c16 c3 ">Tuesday, June 7th</span></h3>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">isosorbide dinitrate (ISDN) Patch</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.scielo.br/pdf/bjps/v51n2/1984-8250-bjps-51-02-00373.pdf&sa=D&ust=1475963638452000&usg=AFQjCNFqjinqCKAQQ9jylFHLzm_A2wI-CA ">http://www.scielo.br/pdf/bjps/v51n2/1984-8250-bjps-51-02-00373.pdf</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">***They are dealing with a drug called isosorbide dinitrate (ISDN) which is used as vasodilator for angina, congestive heart failure, and esophageal spasms.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">What they are trying to create:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_52-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c13 c34 ">Acrylate polymers</span><span class="c1 "> = they used this as the rate controlling membrane, as this polymer has not been extensively used in patches before</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_52-1 start ">
| + | |
| − | <li class="c0 "><span class="c16 c3 c13 c34 ">Why use this</span><span class="c1 ">? keep drug release for at least 48 hours at constant rate</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Here's how their patch looks like: poor mouse :’(</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 294.27px; height: 128.40px; "><img alt="https://lh5.googleusercontent.com/47sngBiSR3vPe3giXNgKjP3ylwNrvQL1Amvl4vEuLd0eugXTpuh13FyF1Ki0nYflGSlUy7z09lwk1I1WE5hxpc4ytZirOVC1bqK-pei8f6_Cfy2dpaSu3d7Je7Jfg0AavL7cJ85P " src="https://static.igem.org/mediawiki/2016/5/50/T--UofC_Calgary--image12.png " style="width: 294.27px; height: 128.40px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 224.40px; height: 132.13px; "><img alt="https://lh4.googleusercontent.com/I8kkgP-xA8u6Or1qC14qMm9IQxNIM7PMH6jIQ0UCQtWlHZsXHMVw91Qjat0GK39QycyMAAaji__lwVzzvyxZMIkR99BJmAgyCAfNKrPNUfICJgCPcsLn5oiDJd_k_Ug8FI88uRch " src="https://static.igem.org/mediawiki/2016/0/0c/T--UofC_Calgary--image13.png " style="width: 224.40px; height: 132.13px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_53-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Patch was stored in a sealed aluminium pouch = minimise the loss of solvent</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <a id="t.0b40ba80bb9ce74fb647b95ebd6c46a1b2bd1647 "></a>
| + | |
| − | <a id="t.1 "></a>
| + | |
| − | <table class="c104 ">
| + | |
| − | <tbody>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c16 c3 c13 c34 ">Part of the Patch</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c16 c3 c13 c34 ">Brand or what material was used</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c52 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c16 c3 c13 c34 ">Why was it chosen</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Backing layer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c18 c94 c15 c14 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c52 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Same material as what is existing</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c69 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Temporary liner and the backing layer were then </span><span class="c16 c3 c13 c34 ">heat-sealed</span><span class="c1 "> and cut to the appropriate sizes</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Temporary Liner</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c16 c3 c13 c34 ">3M, Scotchpak 1022</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c52 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Packaging purposes, protects adhesive</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c69 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Adhesive solution was coated onto the temporary liner (</span><span class="c16 c3 c13 c34 ">3M, Scotchpak 1022</span><span class="c1 ">), allowed to dry completely</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Rate controlling membrane</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Polyacrylate membrane (made from scratch),</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">synthesised</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">by 2-hydroxy-3-phenoxypropylacrylate, 4-hydroxybutyl</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">acrylate and diethyl maleate</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c52 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">To keep drug release for at least 48 hours at constant rate</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Better permeation, does not involve degradation, erosion or dissolution of the polymer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c69 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">These are non-degradable polymers</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Thickness: 14 microns</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c15 c14 c94 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Pore sizes are fabricated randomly by polymer chains</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Reservoir layer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">75% PVA, 10% ISDN and 5% urea</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c52 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Showed better permeation</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Permeation rate is increased by 25.4 fold, a 31.1-fold cumulative release after 24 h, and a 30.8-fold cumulative ratio of release at 24 h compared to EC</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c69 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Also has the penetration enhancers</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c80 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Adhesive layer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c50 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">PSA (pressure sensitive adhesives): 5%</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">ISDN dispersed in the mixture of PVP K90, PEG400</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">and gelatine</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c103 " colspan="2 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">This whole combination helps enhance drug permeation</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c80 ">
| + | |
| − | <td class="c62 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">THEIR CONCLUSION</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c91 " colspan="3 " rowspan="1 ">
| + | |
| − | <p class="c12 c15 "><span class="c1 ">This presented a longer release time at a sustained release rate</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Would promote patient satisfaction</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Sustained release rate, owing to the rate-controlling membrane,</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">A higher loading-drug amount, owing to the separated drug reservoir layer</span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c15 "><span class="c1 ">Easier to tune release rate and release time to achieve the prediction</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | </tbody>
| + | |
| − | </table>
| + | |
| − | <p class="c6 "><span class="c3 c13 c34 c82 ">Patch 2:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c3 c13 c34 c82 ">Contraceptive patch </span><span class="c54 c3 c51 c82 "><a class="c28 " href="https://www.google.com/url?q=http://www.google.com/patents/WO2013112806A2?cl%3Den&sa=D&ust=1475963638486000&usg=AFQjCNGpW4rns7bO-NwrIzgrglYZetDjag ">http://www.google.com/patents/WO2013112806A2?cl=en</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c3 c13 c51 c82 ">Dosage: 20 mg per day, $14 for a full month of medication</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 124.68px; height: 125.49px; "><img alt="https://lh6.googleusercontent.com/sgR4esDJ0XHS6590Z3-2ad_wzcevNi5PjaQwUf4Ubjh0PxmRo3kEK44zV3DSBUrqbpLCLnz9MjDbkhbVVFy32Vn8NCzpge31YV3wXv0yVZwhSZwMR1AasITuja6luUL4iQh8VmmZ " src="https://static.igem.org/mediawiki/2016/c/cb/T--UofC_Calgary--image14.png " style="width: 124.68px; height: 125.49px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c32 c14 "><span class="c7 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <a id="t.add5caefb492a4ca578bc357ef4eb52214d17aea "></a>
| + | |
| − | <a id="t.2 "></a>
| + | |
| − | <table class="c104 ">
| + | |
| − | <tbody>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c72 " colspan="2 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Pros about this patch</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Cons about this patch</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c72 " colspan="2 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Entire patch is flexible enough to effectively and comfortably adhere to contoured sites of the body</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Used destrogel mixed with carriers</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c25 c18 c14 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c23 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Part of the patch</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c58 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Material used</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Why did they use it</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c23 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Backing layer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c58 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c25 c18 c14 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c25 c18 c14 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c23 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Release liner</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c58 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c18 c14 c25 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c25 c18 c14 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c23 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Adhesives</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c58 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Duro Tak® 87-4098 by Henkel Corporation., Bridgewater, N.J.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Comprises a certain percentage of vinyl acetate co-monomer</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">PIB adhesives such as 0.1 to 30 wt% PVP (i.e., povidone) or a PVP co-polymer such as PVP/VA (i.e., copovidone) as a humectant and plasticizer</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c38 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">PVPs are very hydrophilic as compared to PIBs, which are hydrophobic, has an ability to absorb moisture. The use of PVP copolymers, such as PVP/VA, can improve compatibility with other polymers and modulate the water absorption.</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | </tbody>
| + | |
| − | </table>
| + | |
| − | <p class="c15 c14 c31 c48 "><span class="c16 c3 c51 "></span>
| + | |
| − | </p>
| + | |
| − | <a id="t.a985f5d339ab19b7faff4a7c094ef00960f87cfa "></a>
| + | |
| − | <a id="t.3 "></a>
| + | |
| − | <table class="c104 ">
| + | |
| − | <tbody>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c83 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c35 c16 c3 c13 c34 ">Recommendations:</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c66 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">WHY</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c83 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">use of water soluble polymers is generally </span><span class="c16 c3 c13 c34 ">less preferred</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c66 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Would cause dissolution or erosion of the matrix</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Would affect the release rate of the desogestrel</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Would affect capability of the dosage unit to remain in place on the skin</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c83 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Incorporate cross-linking monomeric units or sites</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c66 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Would solve problems with polymers having </span><span class="c16 c3 c13 c34 ">glass transition</span><span class="c1 "> temperatures below room temperature which are used to form a polymer matrix as the transdermal desogestrel-containing composition</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c83 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">In development of suitable polyisobutylene PSAs, one consideration is that PIBs are not crosslinked so they flow slightly.</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c66 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">Within a patch, that slight flow can cause an unsightly ring around the patch when it is worn for several days.</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | <tr class="c42 ">
| + | |
| − | <td class="c83 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c6 "><span class="c1 ">A higher content of high molecular weight PIB in the PSA formulation. </span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">**Polybutene in certain PIB formulations, such as the Oppanol B-12 functions as a plasticizer to allow for incorporation of more high molecular weight PIB.</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Mineral oil can be used as a plasticizer for the same purpose.</span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | <td class="c66 " colspan="1 " rowspan="1 ">
| + | |
| − | <p class="c44 c18 c14 c96 c105 "><span class="c1 c35 "></span>
| + | |
| − | </p>
| + | |
| − | </td>
| + | |
| − | </tr>
| + | |
| − | </tbody>
| + | |
| − | </table>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Wednesday, June 8th</span></h3>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.technicaljournalsonline.com/ijpsr/VOL%2520II/IJPSR%2520VOL%2520II%2520ISSUE%2520I%2520JANUARY%2520MARCH%25202011/IJPSR%2520VOL%2520II%2520ISSUE%2520I%2520Article%252019.pdf&sa=D&ust=1475963638535000&usg=AFQjCNEpqPMk5bh2UKB7jSOWnt_LuSrqIQ ">http://www.technicaljournalsonline.com/ijpsr/VOL%20II/IJPSR%20VOL%20II%20ISSUE%20I%20JANUARY%20MARCH%202011/IJPSR%20VOL%20II%20ISSUE%20I%20Article%2019.pdf</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Polymer requirements:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_54-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Biocompatible + Chemically compatible -> with both drug and body</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 ">Different companies use different polymer systems:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_55-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Alza Corporation: EVA (Ethylene Vinyl Acetate) or microporous polypropylene</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Searle Pharmacia: Silicone rubber</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c29 "><span class="c16 c3 c13 c34 ">Backing Layer: </span><span class="c1 ">Most common is Polyester-polyethylene composite</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c29 "><span class="c16 c3 c13 c34 ">Rate controlling membrane:</span><span class="c1 "> </span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_56-0 start ">
| + | |
| − | <li class="c5 "><span class="c1 ">EVA: The percentage of VA can be manipulated. Higher VA -> higher permeability and higher polarity. Maximum VA is 60% by weight (or else glass transition temperature will increase)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c5 "><span class="c1 "> Silicone rubber: Biocompatible, ease of fabrication, high permeability (especially steroids), free rotation around silicone rubber backbone -> Low microscopic viscosity within polymer</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 "> </span><span class="c16 c3 c13 c34 ">Adhesive:</span><span class="c1 "> (also referred to as PSA) We talked about PIB today</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 "> Release liners:</span><span class="c1 "> Fluoropolymers</span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c3 ">Monday, June 13th </span></h3>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Media Release Material</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Water Soluble Materials</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_64-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Aquasol uses a mixture of sodium carboxy cellulose and wooden pulp to create the water soluble material</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Aquasol specifically designs their packaging to biodegrade over time or with the introduction of water at any various temperature</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Monosol is another company which specializes in the use of water soluble packaging and dispersible materials. The water soluble film is made from PVOH (Poly Vinyl Alcohol)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Like Aquasol, the material is water soluble at all temperatures. At higher temperatures, the material is more soluble. That is why they suggest moderate temperatures of 10-20 degrees celsius with relative humidity of 30-60%</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">With the material being quickly degraded, water soluble materials are not the best materials to use for the media release. The material however does not harm the environment as the bacteria naturally found in wastewater can break it down into harmless components </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">As well, there are no specifics about their material as you have to customize it to your needs</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c1 ">Polyethylene and Bubble Wrap</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_65-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">An alternative would be to use a single layer of polyethylene used for bubble wrap. By filling the media bubble with media and air, it’ll form a pouch that can be popped. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Polycell makes a bubble wrap called Oxo-B Eco Bubble which incorporates their Reverte Oxo Biodegradable into their polyethylene resins. After discard, through the use of substantial UV light, oxygen and/or heat it will break down in smaller pieces. These smaller pieces are then broken down further by the ingestion of bacteria and through respiration will degrade the plastic into carbon dioxide and water. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Will look into plastics that degrade over time</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Membrane:</span><span class="c1 "> </span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_66-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Contacted Dr. Mintchev for a meeting about transdermal patch + materials. </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Reading this paper: page 13</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://www.ualberta.ca/~csps/JPPS8(1)/N.Udupa/glibenclamide.htm&sa=D&ust=1475963638549000&usg=AFQjCNHis0236h2UudT4JI57tGTdjVvHBg ">https://www.ualberta.ca/~csps/JPPS8(1)/N.Udupa/glibenclamide.htm</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_67-0 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">This paper tested EVA 2%, 9% and 19% both </span><span class="c1 c46 ">in vitro</span><span class="c1 "> and </span><span class="c1 c46 ">in vivo</span><span class="c1 ">. The trend held true that the higher the % of EVA, the more drug diffuses.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">They also tested ethyl cellulose, Eudragit RS-100 and Eudragit RL-100 but only </span><span class="c1 c46 ">in vitro.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">The drug was glibenclamide to treat diabetes.</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c77 "><span class="c1 ">Reading this atm:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c77 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=http://www.ema.europa.eu/docs/en_GB/document_library/Scientific_guideline/2014/12/WC500179071.pdf&sa=D&ust=1475963638553000&usg=AFQjCNG7hpYkBMUucJbPN3nCy7LJVdI0Ow ">http://www.ema.europa.eu/docs/en_GB/document_library/Scientific_guideline/2014/12/WC500179071.pdf</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 c13 c34 "><a class="c28 " href="https://www.google.com/url?q=http://www.ema.europa.eu/docs/en_GB/document_library/Scientific_guideline/2014/12/WC500179071.pdf&sa=D&ust=1475963638554000&usg=AFQjCNHp2CP1KW8AdF9tR_1Usm7IPBPH3g "></a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Release Liner:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_68-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Needs to be chemically inert with drug penetration, penetration enhancer and water</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">3M Scotchpak 1022</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">3M Scotchpak 9741</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">3M Scotchpak 9742</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">3M Scotchpak 9744</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">3M Scotchpak 9755</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_68-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Fluoropolymer Coated Polyester Film</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Good for release with silicon skin contact adhesives, acrylate, PIB and rubber based PSA</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Excellent chemical stability</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c16 c3 c13 c34 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">Adhesives:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Links:</span>
| + | |
| − | </p>
| + | |
| − | <ol class="c2 lst-kix_list_69-0 start " start="1 ">
| + | |
| − | <li class="c6 c8 "><span class="c54 c16 c3 c51 "><a class="c28 " href="https://www.google.com/url?q=https://label.averydennison.co.za/content/dam/averydennison/lpm/na/en/doc/home/resource%2520center/Adhesive%2520Overview(1).pdf&sa=D&ust=1475963638560000&usg=AFQjCNF1tpn5f5IrDh6VR1Y9Ghqmz9EhzQ ">https://label.averydennison.co.za/content/dam/averydennison/lpm/na/en/doc/home/resource%20center/Adhesive%20Overview(1).pdf</a></span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c16 c3 c51 c85 c55 "><a class="c28 " href="https://www.google.com/url?q=https://www.researchgate.net/publication/51881833_Adhesive_properties_a_critical_issue_in_transdermal_patch_development_Expert_Opin_Drug_Deliv_933-45&sa=D&ust=1475963638561000&usg=AFQjCNHGwBjaOtPVNBqniE0R5g3NUXz4Pg ">https://www.researchgate.net/publication/51881833_Adhesive_properties_a_critical_issue_in_transdermal_patch_development_Expert_Opin_Drug_Deliv_933-45</a></span>
| + | |
| − | </li>
| + | |
| − | </ol>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 c13 "><a class="c28 " href="https://www.google.com/url?q=https://www.researchgate.net/publication/51881833_Adhesive_properties_a_critical_issue_in_transdermal_patch_development_Expert_Opin_Drug_Deliv_933-45&sa=D&ust=1475963638563000&usg=AFQjCNFZWaEQFB2B3zVSiBEipWrdtPUI1A "></a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c13 ">The typical adhesive properties include:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_70-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 c34 ">Initial Tack</span><span class="c16 c3 c13 "> - The immediate holding power of the label upon contact with the substrate. A label with high initial tack will grab the substrate quickly. A label with low initial tack will exhibit a low level of adhesion when first applied and may remove cleanly.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 c34 ">Ultimate Adhesion</span><span class="c16 c3 c13 "> - The ultimate or maximum holding power that the label will achieve as the adhesive penetrates into the substrate. The time required to obtain ultimate adhesion may depend on the stiffness (shear) of the adhesive, the roughness of the substrate and the temperature of the environment.</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 c34 ">Shear Resistance</span><span class="c16 c3 c13 "> - A measure of the internal cohesive strength of the adhesive. The shear of the adhesive is an indication of how soft an adhesive is. A low-shear adhesive (soft) has more of a tendency to flow (resulting in higher initial tack), and has a higher chance that the adhesive will split apart if put under stress. A high-shear adhesive (firm) is less likely to split under stress because of its good internal cohesive strength, and will be less likely to flow (possibly lower initial tack).</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_57-0 ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Solvent-based</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_68-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Traditionally used in patch production</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Good for extended wear</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Provide tighter hold</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Stingy</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_68-0 ">
| + | |
| − | <li class="c12 c8 c74 "><span class="c1 ">Silicone-based</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_68-1 start ">
| + | |
| − | <li class="c12 c21 c74 "><span class="c1 ">High oxygen/gas permeability</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c74 "><span class="c1 ">Low pain upon removal to sensitive skin</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c74 "><span class="c1 ">Can be customized to improve chemical compatibility and stability with cationic drugs</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 c74 "><span class="c1 ">Increased diffusivity</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Tendency to cause drug crystallization</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_68-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c3 c19 c97 ">DOW CORNING® BIO-PSA 7-4101 SILICONE ADHESIVE, DOW CORNING® BIO-PSA 7-4201 SILICONE ADHESIVE and DOW CORNING® BIO-PSA 7-4301 SILICONE ADHESIVE that way you can compare the different levels of tack. They are all amine compatible with heptane as the carrier solvent.”</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c32 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 391.47px; height: 331.67px; "><img alt="https://lh4.googleusercontent.com/xdtfxPnOp3r5KjOANmMQD20Z_XWvdMr8UqGb2Zv4_gMrNVxhmWd1hD0RryzWOttItduILIEiVqfnaF_ahu0eg443nizevRAyQ0xBeCXRd1Kc3nv-u_Mfeoi3H7M-UDzTGqFnQJDn " src="https://static.igem.org/mediawiki/2016/6/67/T--UofC_Calgary--image15.png " style="width: 391.47px; height: 331.67px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <hr style="page-break-before:always;display:none; ">
| + | |
| − | <p class="c18 c14 "><span class="c3 c59 "></span>
| + | |
| − | </p>
| + | |
| − | <h1 class="c4 "><span class="c3 ">Math Research</span></h1>
| + | |
| − | <p class="c18 c14 "><span class="c3 "></span>
| + | |
| − | </p>
| + | |
| − | <h5 class="c4 "><span class="c3 ">Diffusion:</span></h5>
| + | |
| − | <p class="c6 "><span class="c1 c55 ">Factors affecting diffusivity:</span>
| + | |
| − | </p>
| + | |
| − | <p class="c6 "><span class="c1 ">Search up: Chapter 2: Overview of Controlled Release Mechanisms by Ronald A. Siegel and Michael J. Rathbone</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_47-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Depends on </span><span class="c16 c3 c13 c34 ">size of molecule</span><span class="c1 "> and </span><span class="c16 c3 c13 c34 ">medium</span><span class="c1 ">, as well as the membrane that we’re using</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">For a hard spherical molecule diffusing through:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c22 "><span class="c1 ">Equation: D = kT/(6*pi*a*n)</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_48-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">a = molecule's radius</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">T = absolute temperature (K)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">n = solvent viscosity</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">k = Boltzmann's constant (this accounts for intensity of thermal agitation)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_48-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">In terms of the medium: in</span><span class="c1 c46 "> free volume theory</span><span class="c1 ">, each drug, solvent, and polymer molecule contains an impenetrable core that is surrounded by nanovoids, called free volume</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_48-1 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Thermal motions cause the size of voids to fluctuate. Occasionally, a void becomes large enough for a diffusing molecule to move into or through it</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_49-0 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">Free volume of a matrix depends on the its composition</span>
| + | |
| − | </li>
| + | |
| − | <li class="c0 "><span class="c1 ">Free volume can also be increased substantially by sorption of small molecules, such as water. (sorption is the physical and chemical process by which one substance becomes attached to another)</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_50-0 start ">
| + | |
| − | <li class="c0 "><span class="c1 ">For a molecule diffusing through a water-swollen hydrogel, diffusivity of drug is affected by the viscosity of the water space and also by obstructions placed in the drug molecule’s path by the hydrogel chains</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c6 c14 "><span class="c1 "></span>
| + | |
| − | </p>
| + | |
| − | <h3 class="c4 "><span class="c16 c3 ">Monday, June 6th</span></h3>
| + | |
| − | <p class="c6 "><span class="c16 c3 c13 c34 ">What we need to model:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_59-0 start ">
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Oxygen diffusion through the backing layer (outside to inside and vice versa)</span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">The amount of peptides that go through the rate membrane </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">How much force would we apply to the pouches for them to break </span>
| + | |
| − | </li>
| + | |
| − | <li class="c6 c8 "><span class="c1 ">Mixing of media in patch and in pouches </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Start modelling the system</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_59-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Play around with the sizes of the packets</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Do math around, having some idea about how something works would be necessary, at least we have an idea how it works </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Determine what we’re actually trying to solve</span>
| + | |
| − | </li>
| + | |
| − | <li class="c27 c18 c21 "><span class="c16 c3 c13 ">MATLAB = useful way we could deal with our model - trying different values for a parameter we don’t know about and see how it changed, identify what it represents, it’s a framework of understanding which parameters are important</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <h3 class="c4 "><span class="c16 c3 ">Friday, June 10th</span></h3>
| + | |
| − | <p class="c12 "><span class="c46 c16 c3 c13 ">Rate of release of therapeutic agents from reservoir transdermal systems:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_63-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c54 c16 c3 "><a class="c28 " href="https://www.google.com/url?q=https://www.researchgate.net/file.PostFileLoader.html?id%3D55f196f8614325b8798b456f%26assetKey%3DAS%253A272146475778050%25401441896184273&sa=D&ust=1475963638584000&usg=AFQjCNGYmqF0wVGeq9ehPBwN22CKp5DffQ ">https://www.researchgate.net/file.PostFileLoader.html?id=55f196f8614325b8798b456f&assetKey=AS%3A272146475778050%401441896184273</a></span><span class="c16 c3 c13 "> </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Assuming mechanism of drug delivery involves these steps:</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_63-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Drug dissolution within the reservoir matrix</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Drug diffusion and partitioning into the membrane</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Drug diffusion within the membrane and partitioning into the adhesive layer</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Drug diffusion within the adhesive and partitioning into the stratum corneum</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_63-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Rate controlling membrane controls drug diffusion into the adjacent adhesive layer and therefore is the rate-limiting step in the diffusion process</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 315.40px; height: 79.80px; "><img alt="https://lh4.googleusercontent.com/MF7-NyDC-3v5_Boz8mE8geWeR9JYnhRww_Exief1GZdWQnovYTQtdzgj6BBQAYv6ZHCqG9F4z-e4tboQt-_aLjiVSuR90QM59rbR7qAmdXZyrdYXpixfGGhu8Dcpwc8v29hHsdkT " src="https://static.igem.org/mediawiki/2016/3/3c/T--UofC_Calgary--image02.png " style="width: 315.40px; height: 79.80px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 376.53px; height: 259.33px; "><img alt="https://lh3.googleusercontent.com/VCCXVGBqw0a8nNzCSHjMg9nqvy5RPNbr_B_I5xOnOPgyB2aWJhYIoO7X-o-NYPz5rys6CyeMSTCo4nORL2tUzrzcSxBLVuNzz1EWrPKaoccO8er04jPKUz_jP6MXZAEd68NJzbog " src="https://static.igem.org/mediawiki/2016/6/62/T--UofC_Calgary--image03.png " style="width: 376.53px; height: 259.33px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c85 c55 "><a class="c28 " href="https://www.google.com/url?q=https://www.quora.com/Why-arent-patches-used-as-drug-delivery-systems-more-often&sa=D&ust=1475963638587000&usg=AFQjCNFffDgiJhNL517Coqb0Ho1d_htHCQ ">https://www.quora.com/Why-arent-patches-used-as-drug-delivery-systems-more-often</a></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c55 c85 "><a class="c28 " href="https://www.google.com/url?q=http://ceaccp.oxfordjournals.org/content/7/5/171.full&sa=D&ust=1475963638588000&usg=AFQjCNHLNZSlkX_eV-ZpgTZu56Ex7MaQUA ">http://ceaccp.oxfordjournals.org/content/7/5/171.full</a></span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_23-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Reservoir = drug concentration is established, drug moves further into the skin, into the capillaries, and then into the circulation</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 c53 "><span class="c16 c3 c13 ">There is a time to reach steady state of plasma concentration</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c22 c53 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 491.20px; height: 410.20px; "><img alt="https://lh3.googleusercontent.com/6sT4lf9ZHcREJ5bYiPkbMnT6yn05ekmrOC6UH5fWPHfnqWDBenOxMBSHYbJIo1QL9hk9_Ood8DylxURog4Fx9qX1ks4ri-gdlMz1AKUamEEqmZx7Wv-dTGIV2hVJ7inBHkE1agPs " src="https://static.igem.org/mediawiki/2016/f/f5/T--UofC_Calgary--image04.png " style="width: 491.20px; height: 410.20px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 c13 c34 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 "><span class="c16 c3 c13 c34 ">Parameters that we have to consider</span><span class="c16 c3 c13 ">:</span>
| + | |
| − | </p>
| + | |
| − | <ul class="c2 lst-kix_list_35-0 start ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Diffusing peptide must not affect the adhesive and vice versa</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Skin compatibility, chemical compatibility</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Tack, peel adhesion, skin adhesion and cohesive strength </span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Hydration of skin</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Tissue swells when skin is saturated with water and its permeability increases = this would be an important factor to increase penetration</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Temperature</span>
| + | |
| − | </li>
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Diffusion coefficient</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Diffusion speed of molecules depend on the state of matter in the medium</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Drug concentration</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Drug permeation usually follows the </span><span class="c16 c3 ">F</span><span class="c16 c3 c13 ">ick</span><span class="c16 c3 ">’</span><span class="c16 c3 c13 ">s law. The flux of solute is proportional to the concentration gradient across the entire barrier phase</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Partition coefficient</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-1 start ">
| + | |
| − | <li class="c12 c21 "><span class="c16 c3 c13 ">Important in establishing flux of drug through stratum corneum</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c2 lst-kix_list_35-0 ">
| + | |
| − | <li class="c12 c8 "><span class="c16 c3 c13 ">Molecular size</span>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <p class="c12 c39 c56 "><span style="overflow: hidden; display: inline-block; margin: 0.00px 0.00px; border: 0.00px solid #000000; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); width: 372.80px; height: 269.27px; "><img alt="https://lh6.googleusercontent.com/9UOC_nSDXCR05YIycG4_u8L51N6410loSabIjbS5AeXKiMrH_9vrpJRydb_Z80nacIiPJ-rdaV8BTQ0r-CwtZlnC41m0rYxJEdivjhkbXrCzaWMvmYBtkD1uqbjp8Iil5G4xLqZh " src="https://static.igem.org/mediawiki/2016/f/f4/T--UofC_Calgary--image05.png " style="width: 372.80px; height: 269.27px; margin-left: -0.00px; margin-top: -0.00px; transform: rotate(0.00rad) translateZ(0px); -webkit-transform: rotate(0.00rad) translateZ(0px); " title=" "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 c13 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c12 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c27 c18 c14 "><span class="c16 c3 c13 "></span>
| + | |
| − | </p>
| + | |
| − | <p class="c18 c14 "><span class="c16 c3 "></span>
| + | |
| − | </p>
| + | |
| − | <div>
| + | |
| − | <p class="c18 c14 c88 "><span></span>
| + | |
| − | </p>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − |
| + | |
| − | <!-- END: CONTENT/MISC/ABOUT-1 -->
| + | |
| − | <!-- END: PAGE CONTENT -->
| + | |
| − | </div>
| + | |
| − | <!-- END: PAGE CONTAINER -->
| + | |
| − | <!-- BEGIN: LAYOUT/FOOTERS/FOOTER-5 -->
| + | |
| − | <a name="footer "></a>
| + | |
| − | <footer class="c-layout-footer c-layout-footer-3 c-bg-dark ">
| + | |
| − | <div class="c-prefooter ">
| + | |
| − | <div class="container ">
| + | |
| − | <div class="row ">
| + | |
| − | <div class="col-md-3 ">
| + | |
| − | <div class="c-container c-first ">
| + | |
| − | <div class="c-content-title-1 ">
| + | |
| − | <h3 class="c-font-uppercase c-font-bold c-font-white ">i<span class="c-theme-font ">GEM</span></h3>
| + | |
| − | <div class="c-line-left hide "> | + | |
| | </div> | | </div> |
| − | <p class="c-text ">
| |
| − | Lorem ipsum dolor sit amet, consectetuer adipiscing elit, s ed elit diam nonummy ad minim veniam quis nostrud exerci et tation diam.
| |
| − | </p>
| |
| | </div> | | </div> |
| − | <ul class="c-links "> | + | <!-- End--> <center><object data="https://static.igem.org/mediawiki/2016/3/30/T--UofC_Calgary--chassisjournal.pdf" type="application/pdf" width="100%" height="600px"> |
| − | <li>
| + | Your device does not support embed PDFs. Please click the following link to open up the PDF. <a href=" https://static.igem.org/mediawiki/2016/9/9d/T--UofC_Calgary--ChassisJournalFreeze.pdf"> Chassis_Journal.pdf</a> |
| − | <a href="# ">Home</a>
| + | </object> </center> |
| − | </li>
| + | |
| − | <li>
| + | |
| − | <a href="# ">About</a>
| + | |
| − | </li>
| + | |
| − | <li>
| + | |
| − | <a href="# ">Terms</a>
| + | |
| − | </li>
| + | |
| − | <li>
| + | |
| − | | + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| | </div> | | </div> |
| − | </div>
| + | |
| − | | + | </div> |
| − | <div class="c-container "> | + | <br><br> |
| − | <div class="c-content-title-1 "> | + | <a href="https://static.igem.org/mediawiki/2016/3/30/T--UofC_Calgary--chassisjournal.pdf"<center><p style="text-align: center"><font-size="4"> Click here to view the above PDF</p></font></center></a> |
| − | <h3 class="c-font-uppercase c-font-bold c-font-white ">Latest Entries</h3> | + | </div> |
| − | <div class="c-line-left hide "> | + | <!-- END: CONTENT/MISC/ABOUT-1 --> |
| | + | <!-- BEGIN: CONTENT/MISC/ABOUT-1 --> |
| | + | <div class=" c-content-box c-size-md c- bg-white" id="third"> |
| | + | <div class="container"> |
| | + | <div class="col-md-12"> |
| | + | <!-- Begin: Title 1 component --> |
| | + | <div class="c-content-title-1"> |
| | + | <a href="https://static.igem.org/mediawiki/2016/3/35/T--UofC_Calgary--Devicejournal.pdf"><h3 class="c-font-uppercase c-font-bold">Device Notebook</h3></a> |
| | + | <div class="c-line-left c-theme-bg"> |
| | </div> | | </div> |
| | </div> | | </div> |
| − | <div class="c-blog "> | + | <!-- End--> <center><object data="https://static.igem.org/mediawiki/2016/3/35/T--UofC_Calgary--Devicejournal.pdf" type="application/pdf" width="100%" height="600px"> |
| − | <div class="c-post ">
| + | Your device does not support embed PDFs. Please click the following link to open up the PDF. <a href="https://static.igem.org/mediawiki/2016/3/35/T--UofC_Calgary--Devicejournal.pdf">Device_Journal.pdf</a> |
| − | <div class="c-post-img ">
| + | </object> </center> |
| − | <img src="assets/base/img/content/stock/9.jpg " alt=" " class="img-responsive "/>
| + | |
| − | </div>
| + | |
| − | <div class="c-post-content ">
| + | |
| − | <h4 class="c-post-title "><a href="# ">BBI & KTI Have Arrived!</a></h4>
| + | |
| − | <p class="c-text ">
| + | |
| − | Lorem ipsum dolor sit amet ipsum sit, consectetuer adipiscing elit sit amet
| + | |
| − | </p>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | <div class="c-post c-last ">
| + | |
| − | <div class="c-post-img ">
| + | |
| − | <img src="assets/base/img/content/stock/14.jpg " alt=" " class="img-responsive "/>
| + | |
| − | </div>
| + | |
| − | <div class="c-post-content ">
| + | |
| − | <h4 class="c-post-title "><a href="# ">Fully Trained!</a></h4>
| + | |
| − | <p class="c-text ">
| + | |
| − | Lorem ipsum dolor ipsum sit ipsum amet, consectetuer sit adipiscing elit ipsum elit elit ipsum elit
| + | |
| − | </p>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | <a href="# " class="btn btn-md c-btn-border-1x c-theme-btn c-btn-uppercase c-btn-square c-btn-bold c-read-more hide ">Read More</a>
| + | |
| − | </div>
| + | |
| | </div> | | </div> |
| − | </div>
| + | |
| − | | + | </div> |
| − | <div class="c-container "> | + | <br><br> |
| − | <div class="c-content-title-1 "> | + | <a href="https://static.igem.org/mediawiki/2016/3/35/T--UofC_Calgary--Devicejournal.pdf"<center><p style="text-align: center"><font-size="4"> Click here to view the above PDF</p></font></a> |
| − | <h3 class="c-font-uppercase c-font-bold c-font-white ">Latest Pictures</h3>
| + | </div> |
| − | <div class="c-line-left hide "> | + | <!-- END: CONTENT/MISC/ABOUT-1 --> |
| − | </div>
| + | <!-- END: PAGE CONTENT --> |
| − | </div>
| + | </div><!-- END: PAGE CONTAINER --> |
| − | | + | <!-- BEGIN: LAYOUT/FOOTERS/FOOTER-5 --> |
| − | <li class="c-first ">
| + | <a id="footer" name="footer"></a> |
| − | <a href="https://www.instagram.com/igemcalgary/ "><img src="https://static.igem.org/mediawiki/2016/8/8a/T--UofC_Calgary--wikiinsat8-1.jpg " " class="img-responsive" /> | + | <footer class="c-layout-footer c-layout-footer-3 c-bg-dark"> |
| − | </a>
| + | <div class="c-prefooter"> |
| − | </li>
| + | <div class="container"> |
| − | <li>
| + | <div class="row"> |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/b/b8/T--UofC_Calgary--wikiinsat9.jpg" class="img-responsive" /> | + | |
| − | </a>
| + | <div class="c-container c-first"> |
| − | </li>
| + | <div class="c-content-title-1"> |
| − | <li class="c-last">
| + | <h3 class="c-font-bold c-font-white"> |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/c/c5/T--UofC_Calgary--wikiinsat7.jpg" " class="img-responsive"/></a> | + | i<span class= |
| − | </li>
| + | "c-theme-font">GEM</span></h3> |
| − | </ul>
| + | <div class="c-line-left hide"></div> |
| − | | + | <p class="c-text">iGEM is an |
| − | <li class="c-first">
| + | international competition promoting |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/a/a5/T--UofC_Calgary--wikiinsat6.jpg" class="img-responsive" /> | + | synthetic biology as a means to solve |
| − | </a>
| + | social, economic and humanitarian |
| − | </li>
| + | problems around the globe. The iGEM |
| − | <li>
| + | Jamboree is held in Boston annually. In |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/9/94/T--UofC_Calgary--wikiinsat5.jpg" class="img-responsive" /> | + | 2016, over 300 teams are competing |
| − | </a>
| + | against each other.</p> |
| − | </li>
| + | </div> |
| − | <li class="c-last">
| + | <ul class="c-links"></ul> |
| − | <a href="https://www.instagram.com/igemcalgary"><img src="https://static.igem.org/mediawiki/2016/f/f3/T--UofC_Calgary--wikiinsat4.jpg" class="img-responsive" /> | + | </div> |
| − | </a>
| + | </div> |
| − | </li>
| + | <div class="col-md-3"> |
| − | </ul>
| + | <div class="c-container"> |
| − | | + | <div class="c-content-title-1"> |
| − | <li class="c-first">
| + | <h3 class= |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/5/5e/T--UofC_Calgary--wikiinsat3.jpg" class="img-responsive" alt="" /> | + | "c-font-uppercase c-font-bold c-font-white"> |
| − | </a>
| + | Latest Entries</h3> |
| − | </li>
| + | <div class="c-line-left hide" ></div> |
| − | <li>
| + | </div> |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/2/2a/T--UofC_Calgary--wikiinsat2.jpg" class="img-responsive" alt="" /> | + | <div class="c-blog"> |
| − | </a>
| + | <div class="c-post"></div> |
| − | </li>
| + | <div class="c-post c-last"> |
| − | <li class="c-last">
| + | <div class="c-post-img"><img alt="" |
| − | <a href="https://www.instagram.com/igemcalgary/"><img src="https://static.igem.org/mediawiki/2016/b/b1/T--UofC_Calgary--wikiinsat1.jpg" class="img-responsive" alt="" /> | + | class="img-responsive" src= |
| − | </a>
| + | "https://static.igem.org/mediawiki/2016/d/dc/T--UofC_Calgary--WHMIS.jpg"></div> |
| − | </li>
| + | <div class="c-post-content"> |
| − | </ul>
| + | <h4 class="c-post-title"> |
| − | <a href="#" class="btn btn-md c-btn-border-1x c-theme-btn c-btn-uppercase c-btn-square c-btn-bold c-read-more hide">View More</a> | + | <a href="#">Fully |
| − | </div>
| + | Trained!</a></h4> |
| − | </div>
| + | <p class="c-text">Our entire |
| − | | + | team received a full BioSafety |
| − | <div class="c-container c-last"> | + | education from the University |
| − | <div class="c-content-title-1"> | + | of Calgary! This entailed going |
| − | <h3 class="c-font-uppercase c-font-bold c-font-white">Find us</h3>
| + | to classes to prepare for a |
| − | <div class="c-line-left hide"> | + | final quiz that tested our |
| | + | ability to be safe in the lab. |
| | + | Several of our members also had |
| | + | radiation training and |
| | + | clearance to ensure that work |
| | + | done with radiation was |
| | + | safe!</p> |
| | + | </div> |
| | + | </div><a class= |
| | + | "btn btn-md c-btn-border-1x c-theme-btn c-btn-uppercase c-btn-square c-btn-bold c-read-more hide" |
| | + | href="#">Read More</a> |
| | + | </div> |
| | + | </div> |
| | + | </div> |
| | + | <div class="col-md-3"> |
| | + | <div class="c-container"> |
| | + | <div class="c-content-title-1"> |
| | + | <h3 class= |
| | + | "c-font-uppercase c-font-bold c-font-white"> |
| | + | Latest Pictures</h3> |
| | + | <div class="c-line-left hide"></div> |
| | + | </div> |
| | + | |
| | + | <li class="c-first"> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/8/8a/T--UofC_Calgary--wikiinsat8-1.jpg"></a> |
| | + | </li> |
| | + | <li> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/b/b8/T--UofC_Calgary--wikiinsat9.jpg"></a> |
| | + | </li> |
| | + | <li class="c-last"> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/c/c5/T--UofC_Calgary--wikiinsat7.jpg"></a> |
| | + | </li> |
| | + | </ul> |
| | + | |
| | + | <li class="c- |
| | + | "> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/a/a5/T--UofC_Calgary--wikiinsat6.jpg"></a> |
| | + | </li> |
| | + | <li> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/9/94/T--UofC_Calgary--wikiinsat5.jpg"></a> |
| | + | </li> |
| | + | <li class="c-last"> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary"> |
| | + | <img class="img-responsive" src= |
| | + | "https://static.igem.org/mediawiki/2016/f/f3/T--UofC_Calgary--wikiinsat4.jpg"></a> |
| | + | </li> |
| | + | </ul> |
| | + | |
| | + | <li class="c-first"> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img alt="" class="img-responsive" |
| | + | src= |
| | + | "https://static.igem.org/mediawiki/2016/5/5e/T--UofC_Calgary--wikiinsat3.jpg"></a> |
| | + | </li> |
| | + | <li> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img alt="" class="img-responsive" |
| | + | src= |
| | + | "https://static.igem.org/mediawiki/2016/2/2a/T--UofC_Calgary--wikiinsat2.jpg"></a> |
| | + | </li> |
| | + | <li class="c-last"> |
| | + | |
| | + | "https://www.instagram.com/igemcalgary/"> |
| | + | <img alt="" class="img-responsive" |
| | + | src= |
| | + | "https://static.igem.org/mediawiki/2016/b/b1/T--UofC_Calgary--wikiinsat1.jpg"></a> |
| | + | </li> |
| | + | |
| | + | "btn btn-md c-btn-border-1x c-theme-btn c-btn-uppercase c-btn-square c-btn-bold c-read-more hide" |
| | + | href="#">View More</a> |
| | + | </div> |
| | + | </div> |
| | + | |
| | + | <div class="c-container c-last"> |
| | + | <div class="c-content-title-1"> |
| | + | <h3 class= |
| | + | "c-font-uppercase c-font-bold c-font-white"> |
| | + | Find us</h3> |
| | + | <div class="c-line-left hide" ></div> |
| | + | <p>Located in Calgary, Alberta, |
| | + | Canada.</p> |
| | + | </div> |
| | + | <ul class="c-socials"> |
| | + | <li style="width: 43px;"> |
| | + | <a href= |
| | + | "https://www.facebook.com/igemcalgary/"> |
| | + | <i class= |
| | + | "icon-social-facebook"></i></a> |
| | + | </li> |
| | + | <li style="width: 48px;"> |
| | + | <a href= |
| | + | "https://twitter.com/igemcalgary"><i class="icon-social-twitter"> |
| | + | </i></a> |
| | + | </li> |
| | + | <li> |
| | + | <a href= |
| | + | "http://www.instagram.com/igemcalgary"> |
| | + | <i class="icon-camera"></i></a> |
| | + | </li> |
| | + | </ul> |
| | + | <ul class="c-address"> |
| | + | <li><i class= |
| | + | "icon-pointer c-theme-font"></i> |
| | + | University of Calgary</li> |
| | + | <li><i class= |
| | + | "icon-envelope c-theme-font"></i> |
| | + | igem.calgary@gmail.com</li> |
| | + | </ul> |
| | + | </div> |
| | + | </div> |
| | + | </div> |
| | + | </div> |
| | + | </div> |
| | + | <div class="c-postfooter"> |
| | + | <div class="container"> |
| | + | <p class="c-font-oswald c-font-14">Copyright © |
| | + | University of Calgary 2016.</p> |
| | + | </div> |
| | </div> | | </div> |
| − | <p>
| + | </footer><!-- END: LAYOUT/FOOTERS/FOOTER-5 --> |
| − | Located in Calgary, Alberta, Canada.
| + | <!-- BEGIN: LAYOUT/FOOTERS/GO2TOP --> |
| − | </p>
| + | <div class="c-layout-go2top"> |
| − | </div> | + | <i class="icon-arrow-up"></i> |
| − | <ul class="c-socials">
| + | </div><!-- END: LAYOUT/FOOTERS/GO2TOP --> |
| − | <li style="width: 43px;">
| + | <!-- BEGIN: LAYOUT/BASE/BOTTOM --> |
| − | <a href="https://www.facebook.com/igemcalgary/"><i class="icon-social-facebook"></i></a>
| + | <!-- BEGIN: CORE PLUGINS --> |
| − | </li>
| + | <!--[if lt IE 9]> |
| − | <li style="width: 48px;">
| + | <script src="../assets/global/plugins/excanvas.min.js"></script> |
| − | <a href="https://twitter.com/igemcalgary"><i class="icon-social-twitter"></i></a>
| + | <![endif]--> |
| − | </li>
| + | <!-- END: CORE PLUGINS --> |
| − | <li>
| + | <!-- BEGIN: LAYOUT PLUGINS --> |
| − | <a href="#"><i class="icon-social-youtube"></i></a>
| + | <script> |
| − | </li>
| + | $("#img-scroll1").click(function() { |
| − | <li>
| + | |
| − | <a href="http://www.instagram.com/igemcalgary"><i class="icon-social-instagram"></i></a>
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | <ul class="c-address">
| + | |
| − | <li>
| + | |
| − | <i class="icon-pointer c-theme-font"></i> University of Calgary
| + | |
| − | </li>
| + | |
| − | <li>
| + | |
| − | <i class="icon-call-end c-theme-font"></i> +587 717 7233
| + | |
| − | </li>
| + | |
| − | <li>
| + | |
| − | <i class="icon-envelope c-theme-font"></i> syed.jafri2@ucalgary.ca
| + | |
| − | </li>
| + | |
| − | </ul>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | <div class="c-postfooter">
| + | |
| − | <div class="container">
| + | |
| − | <p class="c-font-oswald c-font-14">
| + | |
| − | Copyright © University of Calgary 2016.
| + | |
| − | </p>
| + | |
| − | </div>
| + | |
| − | </div>
| + | |
| − | </footer>
| + | |
| − | <!-- END: LAYOUT/FOOTERS/FOOTER-5 -->
| + | |
| − | <!-- BEGIN: LAYOUT/FOOTERS/GO2TOP -->
| + | |
| − | <div class="c-layout-go2top"> | + | |
| − | <i class="icon-arrow-up"></i>
| + | |
| − | </div>
| + | |
| − | <!-- END: LAYOUT/FOOTERS/GO2TOP -->
| + | |
| − | <!-- BEGIN: LAYOUT/BASE/BOTTOM -->
| + | |
| − | <!-- BEGIN: CORE PLUGINS -->
| + | |
| − | | + | |
| − | <!--[if lt IE 9]>
| + | |
| − | <script src="../assets/global/plugins/excanvas.min.js"></script>
| + | |
| − | <![endif]-->
| + | |
| − | <!-- END: CORE PLUGINS -->
| + | |
| − | <!-- BEGIN: LAYOUT PLUGINS -->
| + | |
| − | <script>
| + | |
| − | $("#img-scroll1").click(function() {
| + | |
| | $('html,body').animate({ | | $('html,body').animate({ |
| | scrollTop: $("#first").offset().top | | scrollTop: $("#first").offset().top |
| | }, | | }, |
| | 'slow'); | | 'slow'); |
| − | });
| + | }); |
| − | $("#img-scroll2").click(function() {
| + | $("#img-scroll2").click(function() { |
| | $('html,body').animate({ | | $('html,body').animate({ |
| | scrollTop: $("#second").offset().top | | scrollTop: $("#second").offset().top |
| | }, | | }, |
| | 'slow'); | | 'slow'); |
| − | });
| + | }); |
| − | $("#img-scroll3").click(function() {
| + | $("#img-scroll3").click(function() { |
| | $('html,body').animate({ | | $('html,body').animate({ |
| | scrollTop: $("#third").offset().top | | scrollTop: $("#third").offset().top |
| | }, | | }, |
| | 'slow'); | | 'slow'); |
| − | });
| + | }); |
| − | $("#img-scroll4").click(function() {
| + | $("#img-scroll4").click(function() { |
| | $('html,body').animate({ | | $('html,body').animate({ |
| | scrollTop: $("#fourth").offset().top | | scrollTop: $("#fourth").offset().top |
| | }, | | }, |
| | 'slow'); | | 'slow'); |
| − | });
| + | }); |
| − | </script>
| + | </script> |
| − | <script>
| + | <script> |
| − | $(document).ready(function() {
| + | $(document).ready(function() { |
| | App.init(); // init core | | App.init(); // init core |
| | | | |
| Line 23,725: |
Line 633: |
| | hideThumbsUnderResolution: 0 | | hideThumbsUnderResolution: 0 |
| | }); | | }); |
| − | });
| + | }); |
| − | </script>
| + | </script> |
| | + | </div> |
| | + | </div> |
| | </body> | | </body> |
| − |
| |
| | </html> | | </html> |
